Reaction Details |
 | Report a problem with these data |
Target | Retinoic Acid Receptor, alpha |
---|
Ligand | BDBM31883 |
---|
Substrate/Competitor | BDBM31883 |
---|
Meas. Tech. | Retinoid Competition Binding Assay |
---|
pH | 7.9±n/a |
---|
Temperature | 277.15±n/a K |
---|
Kd | 0.4±n/a nM |
---|
Citation | Klaholz BP; Mitschler A; Moras D Structural basis for isotype selectivity of the human retinoic acid nuclear receptor. J Mol Biol 302:155-70 (2000) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Retinoic Acid Receptor, alpha |
---|
Name: | Retinoic Acid Receptor, alpha |
Synonyms: | Nuclear receptor subfamily 1 group B member 1 | RAR-alpha |
Type: | Ligand-binding domain |
Mol. Mass.: | 24746.59 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 220 |
Sequence: | PALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQIT
LLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPL
EMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLM
KITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEG
|
|
|
BDBM31883 |
---|
BDBM31883 |
---|
Name | BDBM31883 |
Synonyms: | 9-cis-retinoic acid (9cRA) | ALL-TRANS-RETINOIC ACID | AT-RA | Atralin | CHEMBL38 | MLS000028588 | SMR000058245 | TRETINOIN | Vitamin A acid | [3H]RA | [3H]Retinoic acid | [3H]Vitamin A acid | [3H]tretinoin | all-trans retinoic acid | cid_444795 |
Type | radiolabeled ligand |
Emp. Form. | C20H28O2 |
Mol. Mass. | 300.4351 |
SMILES | C\C(\C=C\C1=C(C)CCCC1(C)C)=C/C=C/C(/C)=C/C(O)=O |c:4| |
Structure |
|