| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Retinoic acid receptor beta [200-419] |
|---|
| Ligand | BDBM31886 |
|---|
| Substrate/Competitor | BDBM31883 |
|---|
| Meas. Tech. | Retinoid Competition Binding Assay |
|---|
| pH | 7.9±n/a |
|---|
| Temperature | 277.15±n/a K |
|---|
| Kd | 1.2±n/a nM |
|---|
| Citation |  Klaholz, BP; Mitschler, A; Moras, D Structural basis for isotype selectivity of the human retinoic acid nuclear receptor. J Mol Biol302:155-70 (2000) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Retinoic acid receptor beta [200-419] |
|---|
| Name: | Retinoic acid receptor beta [200-419] |
|---|
| Synonyms: | HAP | NR1B2 | Nuclear receptor subfamily 1 group B member 2 | RAR-beta | RAR-epsilon | RARB | RARB_HUMAN | Retinoic Acid Receptor, beta |
|---|
| Type: | Ligand-binding domain |
|---|
| Mol. Mass.: | 24708.23 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P10826[200-419] |
|---|
| Residue: | 220 |
|---|
| Sequence: | PSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQIT
LLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPL
EMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILM
KITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEG
|
|
|
|---|
| BDBM31886 |
|---|
| BDBM31883 |
|---|
| Name | BDBM31886 |
|---|
| Synonyms: | CD564 | CHEMBL309282 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H26O3 |
|---|
| Mol. Mass. | 386.4828 |
|---|
| SMILES | CC1(C)CCC(C)(C)c2cc(ccc12)C(=O)c1ccc2cc(ccc2c1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
