Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoic Acid Receptor, beta
LigandBDBM31892
Substrate/CompetitorBDBM31883
Meas. Tech.Retinoid Competition Binding Assay
pH7.9±n/a
Temperature277.15±n/a K
Kd 0.2±n/a nM
Citation Klaholz BPMitschler AMoras D Structural basis for isotype selectivity of the human retinoic acid nuclear receptor. J Mol Biol 302:155-70 (2000) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Retinoic Acid Receptor, beta
Name:Retinoic Acid Receptor, beta
Synonyms:Nuclear receptor subfamily 1 group B member 2 | RAR-beta | RAR-epsilon
Type:Ligand-binding domain
Mol. Mass.:24708.23
Organism:Homo sapiens (Human)
Description:n/a
Residue:220
Sequence:
PSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQIT
LLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPL
EMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILM
KITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31892
BDBM31883
NameBDBM31892
Synonyms:9-cis retinoic acid | 9C-RA | CHEMBL705 | Panretin | alitretinoin
TypeSmall organic molecule
Emp. Form.C20H28O2
Mol. Mass.300.4351
SMILESC\C(\C=C\C1=C(C)CCCC1(C)C)=C\C=C\C(\C)=C\C(O)=O |c:4|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: