| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase |
|---|
| Ligand | BDBM31907 |
|---|
| Substrate/Competitor | BDBM10852 |
|---|
| Meas. Tech. | SPR Biosensor Assay |
|---|
| pH | 7±n/a |
|---|
| Temperature | 283.15±n/a K |
|---|
| Comments | Inactive. |
|---|
| Citation |  Ramsden, NL; Buetow, L; Dawson, A; Kemp, LA; Ulaganathan, V; Brenk, R; Klebe, G; Hunter, WN A structure-based approach to ligand discovery for 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase: a target for antimicrobial therapy. J Med Chem52:2531-42 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase |
|---|
| Name: | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase |
|---|
| Synonyms: | 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase (IspF) | ISPF_ECOLI | MECDP-synthase | MECPS | ispF | mecS | ygbB |
|---|
| Type: | Homotrimer |
|---|
| Mol. Mass.: | 16897.34 |
|---|
| Organism: | Escherichia coli (strain K12) |
|---|
| Description: | P62617 |
|---|
| Residue: | 159 |
|---|
| Sequence: | MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKL
FPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDL
GCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIKATK
|
|
|
|---|
| BDBM31907 |
|---|
| BDBM10852 |
|---|
| Name | BDBM31907 |
|---|
| Synonyms: | 5-oxopentanoic acid, 4 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H15NO5 |
|---|
| Mol. Mass. | 253.2512 |
|---|
| SMILES | OC(=O)CCCC(=O)NC1=CC2OCOC2C=C1 |c:17,t:9| |
|---|
| Structure | 
|
|---|
Search and Browse
