| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dimer of Gag-Pol polyprotein [489-587,I536L] |
|---|
| Ligand | BDBM517 |
|---|
| Substrate/Competitor | HIV-1 Protease substrate |
|---|
| Meas. Tech. | Protease Inhibition Assay |
|---|
| pH | 5.5±n/a |
|---|
| Temperature | 303.15±n/a K |
|---|
| Ki | 6.615±0.495 nM |
|---|
| Comments | kcat/Km=0.1/sec/mM |
|---|
| Citation |  Vacca, JP; Dorsey, BD; Schleif, WA; Levin, RB; McDaniel, SL; Darke, PL; Zugay, J; Quintero, JC; Blahy, OM; Roth, E L-735,524: an orally bioavailable human immunodeficiency virus type 1 protease inhibitor. Proc Natl Acad Sci U S A91:4096-100 (1994) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Dimer of Gag-Pol polyprotein [489-587,I536L] |
|---|
| Name: | Dimer of Gag-Pol polyprotein [489-587,I536L] |
|---|
| Synonyms: | HIV-1 Protease Mutant (I47L) |
|---|
| Type: | Protein Complex |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | n/a |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | Gag-Pol polyprotein [489-587,I536L] |
|---|
| Synonyms: | HIV-1 Protease Mutant (I47L) chain A | HIV-1 Protease Mutant (I47L) chain B | POL_HV1H2 | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587,I536L] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMLGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| Component 2 |
| Name: | Gag-Pol polyprotein [489-587,I536L] |
|---|
| Synonyms: | HIV-1 Protease Mutant (I47L) chain A | HIV-1 Protease Mutant (I47L) chain B | POL_HV1H2 | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587,I536L] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMLGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM517 |
|---|
| HIV-1 Protease substrate |
|---|
| Name: | HIV-1 Protease substrate |
|---|
| Synonyms: | HIV Protease Peptide Substrate |
|---|
| Type: | Peptide |
|---|
| Mol. Mass.: | 4082.51 |
|---|
| Organism: | n/a |
|---|
| Description: | n/a |
|---|
| Residue: | 38 |
|---|
| Sequence: | Val-Ser-Gln-Asn-beta-naphthylalanine*Pro-Ile-Val
|
|
|
|---|
Search and Browse
