Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target11-beta-Hydroxysteroid Dehydrogenase 1 (11-beta-HSD1)
LigandBDBM32522
Substrate/CompetitorBDBM13739
Meas. Tech.Scintillation Proximity Assay (SPA)
pH6.5±n/a
Temperature296.15±n/a K
IC50 0.1±n/a nM
Citation Wang HRuan ZLi JJSimpkins LMSmirk RAWu SCHutchins RDNirschl DSVan Kirk KCooper CBSutton JCMa ZGolla RSeethala RSalyan MENayeem AKrystek SRSheriff SCamac DMMorin PECarpenter BRobl JAZahler RGordon DAHamann LG Pyridine amides as potent and selective inhibitors of 11beta-hydroxysteroid dehydrogenase type 1. Bioorg Med Chem Lett 18:3168-72 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
11-beta-Hydroxysteroid Dehydrogenase 1 (11-beta-HSD1)
Name:11-beta-Hydroxysteroid Dehydrogenase 1 (11-beta-HSD1)
Synonyms:11-DH | Corticosteroid 11-beta-dehydrogenase isozyme 1
Type:Homodimer
Mol. Mass.:31315.06
Organism:Homo sapiens (Human)
Description:n/a
Residue:286
Sequence:
GSHMASMTGGQQMGRGSNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTAR
SKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSL
NLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSAS
KFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEII
KGGALRQEEVYYDSSRWTTLLIRNPCRKILEELYSTSYNMDRFINK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM32522
BDBM13739
NameBDBM32522
Synonyms:pyridine amide, 30
TypeSmall organic molecule
Emp. Form.C20H23FN2O
Mol. Mass.326.4078
SMILESCc1ccc(cc1F)-c1cccc(n1)C(=O)N1CCCC(C)(C)C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: