Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV-1 Protease Mutant (A71V)
LigandBDBM520
Substrate/CompetitorChromogenic peptide substrate
Meas. Tech.Protease Inhibition Assay
pH4.7±n/a
Temperature310.15±n/a K
Ki 0.5±0.1 nM
Km11000±1000 nM
kcat4.7±0.2 1/sec
Citation Clemente JCHemrajani RBlum LEGoodenow MMDunn BM Secondary mutations M36I and A71V in the human immunodeficiency virus type 1 protease can provide an advantage for the emergence of the primary mutation D30N. Biochemistry 42:15029-35 (2003) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
HIV-1 Protease Mutant (A71V)
Name:HIV-1 Protease Mutant (A71V)
Synonyms:n/a
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:HIV-1 Protease Mutant (A71V) chain A
Synonyms:HIV-1 Protease Mutant (A71V) chain B | LAI (A71V)
Type:Enzyme Subunit
Mol. Mass.:10823.24
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKVIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:HIV-1 Protease Mutant (A71V) chain A
Synonyms:HIV-1 Protease Mutant (A71V) chain B | LAI (A71V)
Type:Enzyme Subunit
Mol. Mass.:10823.24
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKVIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM520
Chromogenic peptide substrate
Name:Chromogenic peptide substrate
Synonyms:Chromogenic peptide substrate
Type:Peptide
Mol. Mass.:1420.11
Organism:n/a
Description:n/a
Residue:13
Sequence:
K-A-R-V-L#Nph-E-A-nL-G