Reaction Details |
| Report a problem with these data |
Target | Dimer of Gag-Pol polyprotein [501-599,D531N,M537I,A572V] |
---|
Ligand | BDBM580 |
---|
Substrate/Competitor | Chromogenic peptide substrate |
---|
Meas. Tech. | Protease Inhibition Assay |
---|
pH | 4.7±n/a |
---|
Temperature | 310.15±n/a K |
---|
Ki | 0.32±0.09 nM |
---|
Km | 12000±2000 nM |
---|
kcat | 21±2 1/sec |
---|
Citation | Clemente, JC; Hemrajani, R; Blum, LE; Goodenow, MM; Dunn, BM Secondary mutations M36I and A71V in the human immunodeficiency virus type 1 protease can provide an advantage for the emergence of the primary mutation D30N. Biochemistry42:15029-35 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Dimer of Gag-Pol polyprotein [501-599,D531N,M537I,A572V] |
---|
Name: | Dimer of Gag-Pol polyprotein [501-599,D531N,M537I,A572V] |
Synonyms: | HIV-1 Protease Mutant (D30N/M36I/A71V) |
Type: | Protein Complex |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 2 components. |
Component 1 |
Name: | Gag-Pol polyprotein [501-599,D531N,M537I,A572V] |
Synonyms: | HIV-1 Protease Mutant (D30N/M36I/A71V) chain A | HIV-1 Protease Mutant (D30N/M36I/A71V) chain B | POL_HV1BR | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10805.22 |
Organism: | Human immunodeficiency virus type 1 |
Description: | The protease species are from laboratory strain LAI |
Residue: | 99 |
Sequence: | PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEEISLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKVIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
Component 2 |
Name: | Gag-Pol polyprotein [501-599,D531N,M537I,A572V] |
Synonyms: | HIV-1 Protease Mutant (D30N/M36I/A71V) chain A | HIV-1 Protease Mutant (D30N/M36I/A71V) chain B | POL_HV1BR | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10805.22 |
Organism: | Human immunodeficiency virus type 1 |
Description: | The protease species are from laboratory strain LAI |
Residue: | 99 |
Sequence: | PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEEISLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKVIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM580 |
---|
Chromogenic peptide substrate |
---|
Name: | Chromogenic peptide substrate |
Synonyms: | Chromogenic peptide substrate |
Type: | Peptide |
Mol. Mass.: | 1420.11 |
Organism: | n/a |
Description: | n/a |
Residue: | 13 |
Sequence: | |