| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Genome polyprotein [1424-1463]/[1502-1685] |
|---|
| Ligand | BDBM33264 |
|---|
| Substrate/Competitor | BDBM33263 |
|---|
| Meas. Tech. | Protease Inhibition Assay |
|---|
| pH | 8.5±n/a |
|---|
| Temperature | 296.15±n/a K |
|---|
| Ki | 16000±2000 nM |
|---|
| Citation |  Ganesh, VK; Muller, N; Judge, K; Luan, CH; Padmanabhan, R; Murthy, KH Identification and characterization of nonsubstrate based inhibitors of the essential dengue and West Nile virus proteases. Bioorg Med Chem13:257-64 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Genome polyprotein [1424-1463]/[1502-1685] |
|---|
| Name: | Genome polyprotein [1424-1463]/[1502-1685] |
|---|
| Synonyms: | WNV CF40.Gly.NS3Pro | WNV NS2B(H):NS3 | West Nile Virus (WNV) NS2B-NS3 Protease |
|---|
| Type: | Cofactor/Enzyme |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | It is the catalytically active recombinant WNV protease, consisting of a 40-residue component of cofactor NS2B tethered via a nonapeptide (G4SG4) to the N-terminal 184 residues of NS3. |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | Genome polyprotein [1424-1463] |
|---|
| Synonyms: | Flavivirin protease NS2B regulatory subunit | NS2B | POLG_WNV |
|---|
| Type: | Cofactor Domain |
|---|
| Mol. Mass.: | 4431.59 |
|---|
| Organism: | West Nile virus (WNV) |
|---|
| Description: | P06935[1424-1463] |
|---|
| Residue: | 40 |
|---|
| Sequence: | IERTADITWESDAEITGSSERVDVRLDDDGNFQLMNDPGA
|
|
|
|---|
| Component 2 |
| Name: | Genome polyprotein [1502-1685] |
|---|
| Synonyms: | Flavivirin protease NS3 catalytic subunit | NS3 | POLG_WNV |
|---|
| Type: | Catalytic Subunit |
|---|
| Mol. Mass.: | 19839.27 |
|---|
| Organism: | West Nile virus (WNV) |
|---|
| Description: | P06935[1502-1685] |
|---|
| Residue: | 184 |
|---|
| Sequence: | GGVLWDTPSPKEYKKGDTTTGVYRIMTRGLLGSYQAGAGVMVEGVFHTLWHTTKGAALMS
GEGRLDPYWGSVKEDRLCYGGPWKLQHKWNGHDEVQMIVVEPGKNVKNVQTKPGVFKTPE
GEIGAVTLDYPTGTSGSPIVDKNGDVIGLYGNGVIMPNGSYISAIVQGERMEEPAPAGFE
PEML
|
|
|
|---|
| BDBM33264 |
|---|
| BDBM33263 |
|---|
| Name | BDBM33264 |
|---|
| Synonyms: | guanidine, 4 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C9H9N5O |
|---|
| Mol. Mass. | 203.2007 |
|---|
| SMILES | [#7]\[#6](-[#7])=[#7]\[#7]=[#6]-1-[#6](=O)-[#7]-c2ccccc-12 |w:4.3| |
|---|
| Structure | 
|
|---|
Search and Browse
