Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase III
LigandBDBM33282
Substrate/CompetitorBDBM10856
Meas. Tech.CA Inhibition Assay
pH7.5±n/a
Temperature296.15±n/a K
Ki 1206±n/a nM
Citation Vitale RMAlterio VInnocenti AWinum JYMonti SMDe Simone GSupuran CT Carbonic anhydrase inhibitors. Comparison of aliphatic sulfamate/bis-sulfamate adducts with isozymes II and IX as a platform for designing tight-binding, more isoform-selective inhibitors. J Med Chem 52:5990-8 (2009) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Carbonic Anhydrase III
Name:Carbonic Anhydrase III
Synonyms:CA-III | Carbonate dehydratase III | Carbonic anhydrase 3 (CA III) | Carbonic anhydrase III (CA III)
Type:Enzyme
Mol. Mass.:29562.11
Organism:Homo sapiens (Human)
Description:Human cloned isozyme.
Residue:260
Sequence:
MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHL
VHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDP
SCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPL
VSNWRPPQPINNRVVRASFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM33282
BDBM10856
NameBDBM33282
Synonyms:CHEMBL171476 | bis-sulfamate, 4
TypeSmall organic molecule
Emp. Form.C10H24N2O6S2
Mol. Mass.332.437
SMILESNS(=O)(=O)OCCCCCCCCCCOS(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: