| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase 13 |
|---|
| Ligand | BDBM10884 |
|---|
| Substrate/Competitor | BDBM10856 |
|---|
| Meas. Tech. | CA Inhibition Assay |
|---|
| Ki | 18±n/a nM |
|---|
| Citation |  Vitale, RM; Alterio, V; Innocenti, A; Winum, JY; Monti, SM; De Simone, G; Supuran, CT Carbonic anhydrase inhibitors. Comparison of aliphatic sulfamate/bis-sulfamate adducts with isozymes II and IX as a platform for designing tight-binding, more isoform-selective inhibitors. J Med Chem52:5990-8 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Carbonic anhydrase 13 |
|---|
| Name: | Carbonic anhydrase 13 |
|---|
| Synonyms: | CA-XIII | CAH13_MOUSE | Ca13 | Car13 | Carbonate dehydratase XIII | Carbonic anhydrase 13 | Carbonic anhydrase XIII |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 29522.80 |
|---|
| Organism: | Mus musculus (mouse) |
|---|
| Description: | Murine cloned isozyme |
|---|
| Residue: | 262 |
|---|
| Sequence: | MARLSWGYGEHNGPIHWNELFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPASAKII
SNSGHSFNVDFDDTEDKSVLRGGPLTGNYRLRQFHLHWGSADDHGSEHVVDGVRYAAELH
VVHWNSDKYPSFVEAAHESDGLAVLGVFLQIGEHNPQLQKITDILDSIKEKGKQTRFTNF
DPLCLLPSSWDYWTYPGSLTVPPLLESVTWIVLKQPISISSQQLARFRSLLCTAEGESAA
FLLSNHRPPQPLKGRRVRASFY
|
|
|
|---|
| BDBM10884 |
|---|
| BDBM10856 |
|---|
| Name | BDBM10884 |
|---|
| Synonyms: | (2S,4S)-4-(ethylamino)-2-methyl-1,1-dioxo-2H,3H,4H-1,7-thieno[2,3-b]thiopyran-6-sulfonamide | Dorzolamide (DRZ) | Dorzolamide (DZA) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H16N2O4S3 |
|---|
| Mol. Mass. | 324.44 |
|---|
| SMILES | CCN[C@H]1C[C@H](C)S(=O)(=O)c2sc(cc12)S(N)(=O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
