Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV-1 Protease
LigandBDBM795
Substrate/CompetitorFluorogenic substrate Abz-NF-6*
Meas. Tech.Protease Inhibition Assay
pH6.5±n/a
Temperature310.15±n/a K
Ki 0.9±n/a nM
Citation Glenn MPPattenden LKReid RCTyssen DPTyndall JDBirch CJFairlie DP Beta-strand mimicking macrocyclic amino acids: templates for protease inhibitors with antiviral activity. J Med Chem 45:371-81 (2002) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
HIV-1 Protease
Name:HIV-1 Protease
Synonyms:n/a
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:HIV-1 Protease chain B
Synonyms:HIV-1 Mutant (C67B, C95B, Q7K, L33I, where B is L-R-amino-nbutyric acid) | Synthetic HIV PR (SF2 isolate)
Type:Enzyme Subunit
Mol. Mass.:10586.91
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:97
Sequence:
PQITLWKRPLVTIRIGGQLKEALLDTGADDTVIEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEIGHKAIGTVLVGPTPVNIIGRNLLTQIGTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:HIV-1 Protease chain B
Synonyms:HIV-1 Mutant (C67B, C95B, Q7K, L33I, where B is L-R-amino-nbutyric acid) | Synthetic HIV PR (SF2 isolate)
Type:Enzyme Subunit
Mol. Mass.:10586.91
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:97
Sequence:
PQITLWKRPLVTIRIGGQLKEALLDTGADDTVIEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEIGHKAIGTVLVGPTPVNIIGRNLLTQIGTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM795
Fluorogenic substrate Abz-NF-6*
Name:Fluorogenic substrate Abz-NF-6*
Synonyms:n/a
Type:Peptide
Mol. Mass.:358.43
Organism:n/a
Description:n/a
Residue:3
Sequence:
n/a