| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dimer of Gag-Pol polyprotein [491-589,Q7K,L33I,C67B,C95B] |
|---|
| Ligand | BDBM804 |
|---|
| Substrate/Competitor | Fluorogenic substrate Abz-NF-6* |
|---|
| Meas. Tech. | Protease Inhibition Assay |
|---|
| pH | 6.5±n/a |
|---|
| Temperature | 310.15±n/a K |
|---|
| Ki | 45±n/a nM |
|---|
| Citation |  Glenn, MP; Pattenden, LK; Reid, RC; Tyssen, DP; Tyndall, JD; Birch, CJ; Fairlie, DP Beta-strand mimicking macrocyclic amino acids: templates for protease inhibitors with antiviral activity. J Med Chem45:371-81 (2002) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Dimer of Gag-Pol polyprotein [491-589,Q7K,L33I,C67B,C95B] |
|---|
| Name: | Dimer of Gag-Pol polyprotein [491-589,Q7K,L33I,C67B,C95B] |
|---|
| Synonyms: | HIV-1 Protease |
|---|
| Type: | Protein Complex |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | n/a |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | Gag-Pol polyprotein [491-589,Q7K,L33I,C67B,C95B] |
|---|
| Synonyms: | HIV-1 Mutant (C67B, C95B, Q7K, L33I, where B is L-R-amino-nbutyric acid) | HIV-1 Protease chain B | POL_HV1A2 | Synthetic HIV PR (SF2 isolate) | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10586.91 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P03369[491-589,Q7K,L33I,C67B,C95B] |
|---|
| Residue: | 97 |
|---|
| Sequence: | PQITLWKRPLVTIRIGGQLKEALLDTGADDTVIEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEIGHKAIGTVLVGPTPVNIIGRNLLTQIGTLNF
|
|
|
|---|
| Component 2 |
| Name: | Gag-Pol polyprotein [491-589,Q7K,L33I,C67B,C95B] |
|---|
| Synonyms: | HIV-1 Mutant (C67B, C95B, Q7K, L33I, where B is L-R-amino-nbutyric acid) | HIV-1 Protease chain B | POL_HV1A2 | Synthetic HIV PR (SF2 isolate) | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10586.91 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P03369[491-589,Q7K,L33I,C67B,C95B] |
|---|
| Residue: | 97 |
|---|
| Sequence: | PQITLWKRPLVTIRIGGQLKEALLDTGADDTVIEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEIGHKAIGTVLVGPTPVNIIGRNLLTQIGTLNF
|
|
|
|---|
| BDBM804 |
|---|
| Fluorogenic substrate Abz-NF-6* |
|---|
| Name: | Fluorogenic substrate Abz-NF-6* |
|---|
| Synonyms: | n/a |
|---|
| Type: | Peptide |
|---|
| Mol. Mass.: | 358.43 |
|---|
| Organism: | n/a |
|---|
| Description: | n/a |
|---|
| Residue: | 3 |
|---|
| Sequence: | |
|---|
Search and Browse
