Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV-1 Reverse Transcriptase RNase H Mutant (L100I/K103N)
LigandBDBM2483
Substrate/CompetitorRNA/DNA hybrid
Meas. Tech.Assay of RT RNH Activity
Citation Himmel DMSarafianos SGDharmasena SHossain MMMcCoy-Simandle KIlina TClark ADKnight JLJulias JGClark PKKrogh-Jespersen KLevy RMHughes SHParniak MAArnold E HIV-1 reverse transcriptase structure with RNase H inhibitor dihydroxy benzoyl naphthyl hydrazone bound at a novel site. ACS Chem Biol 1:702-12 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
HIV-1 Reverse Transcriptase RNase H Mutant (L100I/K103N)
Name:HIV-1 Reverse Transcriptase RNase H Mutant (L100I/K103N)
Synonyms:n/a
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:HIV-1 Reverse Transcriptase RNase H Mutant (L100I/K103N) Chain A
Synonyms:n/a
Type:Enzyme Subunit
Mol. Mass.:63569.30
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:552
Sequence:
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:HIV-1 Reverse Transcriptase RNase H Mutant (L100I/K103N) Chain B
Synonyms:n/a
Type:Enzyme Subunit
Mol. Mass.:50078.66
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:429
Sequence:
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM2483
RNA/DNA hybrid
Name:RNA/DNA hybrid
Synonyms:n/a
Type:fluorescein-labeled RNA annealed to DNA
Mol. Mass.:2134.40
Organism:n/a
Description:It is a 18-nucleotide 3-fluorescein-labeled RNA annealed to a complementary 18-nucleotide 5-Dabcyl-modified DNA.
Residue:23
Sequence:
5-GAU CUG AGC CUG GGA GCU-fluorescein-3