| Reaction Details |
|---|
 | Report a problem with these data |
| Target | beta-Carbonic Anhydrase |
|---|
| Ligand | BDBM10864 |
|---|
| Substrate/Competitor | BDBM10856 |
|---|
| Meas. Tech. | CA Inhibition Assay |
|---|
| pH | 8.3±n/a |
|---|
| Temperature | 293.15±n/a K |
|---|
| Ki | 408±n/a nM |
|---|
| Citation |  Innocenti A; Hall RA; Schlicker C; Scozzafava A; Steegborn C; Mühlschlegel FA; Supuran CT Carbonic anhydrase inhibitors. Inhibition and homology modeling studies of the fungal beta-carbonic anhydrase from Candida albicans with sulfonamides. Bioorg Med Chem 17:4503-9 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| beta-Carbonic Anhydrase |
|---|
| Name: | beta-Carbonic Anhydrase |
|---|
| Synonyms: | NCE103 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 31587.59 |
|---|
| Organism: | Candida albicans (Yeast) |
|---|
| Description: | n/a |
|---|
| Residue: | 281 |
|---|
| Sequence: | MGRENILKYQLEHDHESDLVTEKDQSLLLDNNNNLNGMNNTIKTHPVRVSSGNHNNFPFT
LSSESTLQDFLNNNKFFVDSIKHNHGNQIFDLNGQGQSPHTLWIGCSDSRAGDQCLATLP
GEIFVHRNIANIVNANDISSQGVIQFAIDVLKVKKIIVCGHTDCGGIWASLSKKKIGGVL
DLWLNPVRHIRAANLKLLEEYNQDPKLKAKKLAELNVISSVTALKRHPSASVALKKNEIE
VWGMLYDVATGYLSQVEIPQDEFEDLFHVHDEHDEEEYNPH
|
|
|
|---|
| BDBM10864 |
|---|
| BDBM10856 |
|---|
| Name | BDBM10864 |
|---|
| Synonyms: | 4-Amino-3-bromobenzenesulfonamide | 4-amino-3-bromobenzene-1-sulfonamide | CHEMBL6724 | aromatic/heteroaromatic sulfonamide 9 | halogenosulfanilamide deriv. 5d |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C6H7BrN2O2S |
|---|
| Mol. Mass. | 251.101 |
|---|
| SMILES | Nc1ccc(cc1Br)S(N)(=O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
