Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetbeta-Carbonic Anhydrase
LigandBDBM11639
Substrate/CompetitorBDBM10856
Meas. Tech.CA Inhibition Assay
Ki 1017±n/a nM
Citation Innocenti AHall RASchlicker CScozzafava ASteegborn CMühlschlegel FASupuran CT Carbonic anhydrase inhibitors. Inhibition and homology modeling studies of the fungal beta-carbonic anhydrase from Candida albicans with sulfonamides. Bioorg Med Chem 17:4503-9 (2009) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
beta-Carbonic Anhydrase
Name:beta-Carbonic Anhydrase
Synonyms:NCE103
Type:Enzyme
Mol. Mass.:31587.59
Organism:Candida albicans (Yeast)
Description:n/a
Residue:281
Sequence:
MGRENILKYQLEHDHESDLVTEKDQSLLLDNNNNLNGMNNTIKTHPVRVSSGNHNNFPFT
LSSESTLQDFLNNNKFFVDSIKHNHGNQIFDLNGQGQSPHTLWIGCSDSRAGDQCLATLP
GEIFVHRNIANIVNANDISSQGVIQFAIDVLKVKKIIVCGHTDCGGIWASLSKKKIGGVL
DLWLNPVRHIRAANLKLLEEYNQDPKLKAKKLAELNVISSVTALKRHPSASVALKKNEIE
VWGMLYDVATGYLSQVEIPQDEFEDLFHVHDEHDEEEYNPH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM11639
BDBM10856
NameBDBM11639
Synonyms:4-[5-(4-methylphenyl)-3-(trifluoromethyl)-1H-pyrazol-1-yl]benzene-1-sulfonamide | CHEMBL118 | CLX | Celebrex | Celecoxib | US8741944, Comparative Compound | US9388139, Celecoxib | cid_2662
TypeSmall organic molecule
Emp. Form.C17H14F3N3O2S
Mol. Mass.381.372
SMILESCc1ccc(cc1)-c1cc(nn1-c1ccc(cc1)S(N)(=O)=O)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: