Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase 2 (Can2)
LigandBDBM10876
Substrate/CompetitorBDBM10856
Meas. Tech.CA Inhibition Assay
Ki 623±n/a nM
Citation Innocenti AHall RASchlicker CScozzafava ASteegborn CMühlschlegel FASupuran CT Carbonic anhydrase inhibitors. Inhibition and homology modeling studies of the fungal beta-carbonic anhydrase from Candida albicans with sulfonamides. Bioorg Med Chem 17:4503-9 (2009) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Carbonic Anhydrase 2 (Can2)
Name:Carbonic Anhydrase 2 (Can2)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:26594.37
Organism:Cryptococcus neoformans var. grubii (Filobasidiella neoformans var. grubii)
Description:n/a
Residue:239
Sequence:
MPFHAEPLKPSDEIDMDLGHSVAAQKFKEIREVLEGNRYWARKVTSEEPEFMAEQVKGQA
PNFLWIGCADSRVPEVTIMARKPGDVFVQRNVANQFKPEDDSSQALLNYAIMNVGVTHVM
VVGHTGCGGCIAAFDQPLPTEENPGGTPLVRYLEPIIRLKHSLPEGSDVNDLIKENVKMA
VKNVVNSPTIQGAWEQARKGEFREVFVHGWLYDLSTGNIVDLNVTQGPHPFVDDRVPRA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10876
BDBM10856
NameBDBM10876
Synonyms:4-(hydroxymethyl)benzene-1-sulfonamide | CHEMBL6919 | JMC522226 Compound 20 | JMC523116 Compound 20 | aromatic/heteroaromatic sulfonamide 21
TypeSmall organic molecule
Emp. Form.C7H9NO3S
Mol. Mass.187.216
SMILESNS(=O)(=O)c1ccc(CO)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: