Reaction Details |
| Report a problem with these data |
Target | Dimer of Gag-Pol polyprotein [489-587,Q496K,L499I,M525I,S526D,M535I,R546K,L552P,A560V,G562S,I573V,L579M,I582L] |
---|
Ligand | BDBM519 |
---|
Substrate/Competitor | fluorogenic peptide substrate, SQNY/PIVQ |
---|
Meas. Tech. | Protease Inhibition Assay |
---|
pH | 5±n/a |
---|
Temperature | 298.15±n/a K |
---|
Ki | 1948±198 nM |
---|
Km | 23290±2350 nM |
---|
kcat | 1.51±0.06 1/sec |
---|
Citation | Muzammil, S; Muzammil, S; Ross, P; Ross, P; Freire, E; Freire, E A major role for a set of non-active site mutations in the development of HIV-1 protease drug resistance. Biochemistry42:631-8 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Dimer of Gag-Pol polyprotein [489-587,Q496K,L499I,M525I,S526D,M535I,R546K,L552P,A560V,G562S,I573V,L579M,I582L] |
---|
Name: | Dimer of Gag-Pol polyprotein [489-587,Q496K,L499I,M525I,S526D,M535I,R546K,L552P,A560V,G562S,I573V,L579M,I582L] |
Synonyms: | HIV-1 Protease Mutant, ANAM-11 |
Type: | Protein Complex |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 2 components. |
Component 1 |
Name: | Gag-Pol polyprotein [489-587,Q496K,L499I,M525I,S526D,M535I,R546K,L552P,A560V,G562S,I573V,L579M,I582L] |
Synonyms: | HIV-1 Protease Mutant (Q7K/L10I/M36I/S37D/M46I/R57K/L63P/A71V/G73S/I84V/L90M/I93L) | HIV-1 Protease Mutant, ANAM-11 chain A | HIV-1 Protease Mutant, ANAM-11 chain B | POL_HV1H2 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10791.17 |
Organism: | Human immunodeficiency virus type 1 |
Description: | All of the protease constructs in this study are on the wild type containing the single Q7K mutation to prevent autocatalysis.This protein has enzymatic properties similar to that of the wild type protease. |
Residue: | 99 |
Sequence: | PQVTLWKRPIVTIKIGGQLKEALLDTGADDTVLEEIDLPGRWKPKIIGGIGGFIKVKQYD
QIPIEICGHKVISTVLVGPTPVNVIGRNLMTQLGCTLNF
|
|
|
Component 2 |
Name: | Gag-Pol polyprotein [489-587,Q496K,L499I,M525I,S526D,M535I,R546K,L552P,A560V,G562S,I573V,L579M,I582L] |
Synonyms: | HIV-1 Protease Mutant (Q7K/L10I/M36I/S37D/M46I/R57K/L63P/A71V/G73S/I84V/L90M/I93L) | HIV-1 Protease Mutant, ANAM-11 chain A | HIV-1 Protease Mutant, ANAM-11 chain B | POL_HV1H2 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10791.17 |
Organism: | Human immunodeficiency virus type 1 |
Description: | All of the protease constructs in this study are on the wild type containing the single Q7K mutation to prevent autocatalysis.This protein has enzymatic properties similar to that of the wild type protease. |
Residue: | 99 |
Sequence: | PQVTLWKRPIVTIKIGGQLKEALLDTGADDTVLEEIDLPGRWKPKIIGGIGGFIKVKQYD
QIPIEICGHKVISTVLVGPTPVNVIGRNLMTQLGCTLNF
|
|
|
BDBM519 |
---|
fluorogenic peptide substrate, SQNY/PIVQ |
---|
Name: | fluorogenic peptide substrate, SQNY/PIVQ |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 4728.18 |
Organism: | n/a |
Description: | n/a |
Residue: | 44 |
Sequence: | Arg-Glu(EDANS)-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-Lys(DABCYL)-A
rg
|
|
|