Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV-1 Protease Mutant, ANAM-11
LigandBDBM520
Substrate/Competitorfluorogenic peptide substrate, SQNY/PIVQ
Meas. Tech.Protease Inhibition Assay
pH5±n/a
Temperature298.15±n/a K
Ki 2107±123 nM
Km23290±2350 nM
kcat1.51±0.06 1/sec
Citation Muzammil SMuzammil SRoss PRoss PFreire EFreire E A major role for a set of non-active site mutations in the development of HIV-1 protease drug resistance. Biochemistry 42:631-8 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
HIV-1 Protease Mutant, ANAM-11
Name:HIV-1 Protease Mutant, ANAM-11
Synonyms:n/a
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:HIV-1 Protease Mutant, ANAM-11 chain A
Synonyms:HIV-1 Protease Mutant (Q7K/L10I/M36I/S37D/M46I/R57K/L63P/A71V/G73S/I84V/L90M/I93L) | HIV-1 Protease Mutant, ANAM-11 chain B
Type:Enzyme Subunit
Mol. Mass.:10791.17
Organism:Human immunodeficiency virus type 1
Description:All of the protease constructs in this study are on the wild type containing the single Q7K mutation to prevent autocatalysis.This protein has enzymatic properties similar to that of the wild type protease.
Residue:99
Sequence:
PQVTLWKRPIVTIKIGGQLKEALLDTGADDTVLEEIDLPGRWKPKIIGGIGGFIKVKQYD
QIPIEICGHKVISTVLVGPTPVNVIGRNLMTQLGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:HIV-1 Protease Mutant, ANAM-11 chain A
Synonyms:HIV-1 Protease Mutant (Q7K/L10I/M36I/S37D/M46I/R57K/L63P/A71V/G73S/I84V/L90M/I93L) | HIV-1 Protease Mutant, ANAM-11 chain B
Type:Enzyme Subunit
Mol. Mass.:10791.17
Organism:Human immunodeficiency virus type 1
Description:All of the protease constructs in this study are on the wild type containing the single Q7K mutation to prevent autocatalysis.This protein has enzymatic properties similar to that of the wild type protease.
Residue:99
Sequence:
PQVTLWKRPIVTIKIGGQLKEALLDTGADDTVLEEIDLPGRWKPKIIGGIGGFIKVKQYD
QIPIEICGHKVISTVLVGPTPVNVIGRNLMTQLGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM520
fluorogenic peptide substrate, SQNY/PIVQ
Name:fluorogenic peptide substrate, SQNY/PIVQ
Synonyms:n/a
Type:Peptide
Mol. Mass.:4728.18
Organism:n/a
Description:n/a
Residue:44
Sequence:
Arg-Glu(EDANS)-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-Lys(DABCYL)-A
rg