Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase pim-2
LigandBDBM35034
Substrate/CompetitorBiotinylated Substrate Peptide
Meas. Tech.Pim Kinase Assay
Temperature298.15±n/a K
Ki 3±n/a nM
Commentsextracted
Citation Tao ZFHasvold LALeverson JDHan EKGuan RJohnson EFStoll VSStewart KDStamper GSoni NBouska JJLuo YSowin TJLin NHGiranda VSRosenberg SHPenning TD Discovery of 3H-benzo[4,5]thieno[3,2-d]pyrimidin-4-ones as potent, highly selective, and orally bioavailable inhibitors of the human protooncogene proviral insertion site in moloney murine leukemia virus (PIM) kinases. J Med Chem 52:6621-36 (2009) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Serine/threonine-protein kinase pim-2
Name:Serine/threonine-protein kinase pim-2
Synonyms:Pim-2h | Serine/threonine-protein kinase (PIM2) | Serine/threonine-protein kinase pim-2 (PIM2)
Type:Serine/threonine-protein kinase
Mol. Mass.:34185.93
Organism:Homo sapiens (Human)
Description:n/a
Residue:311
Sequence:
MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAI
KVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL
PAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKL
IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFER
DQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG
GPAPLAWSLLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM35034
Biotinylated Substrate Peptide
Name:Biotinylated Substrate Peptide
Synonyms:n/a
Type:Peptide
Mol. Mass.:2871.44
Organism:n/a
Description:n/a
Residue:24
Sequence:
biotin-C6linker-VRRLRRLTAREAA