Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase pim-3
LigandBDBM35048
Substrate/CompetitorBiotinylated Substrate Peptide
Meas. Tech.Pim Kinase Assay
Temperature298.15±n/a K
Ki 0.4±n/a nM
Commentsextracted
Citation Tao ZFHasvold LALeverson JDHan EKGuan RJohnson EFStoll VSStewart KDStamper GSoni NBouska JJLuo YSowin TJLin NHGiranda VSRosenberg SHPenning TD Discovery of 3H-benzo[4,5]thieno[3,2-d]pyrimidin-4-ones as potent, highly selective, and orally bioavailable inhibitors of the human protooncogene proviral insertion site in moloney murine leukemia virus (PIM) kinases. J Med Chem 52:6621-36 (2009) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Serine/threonine-protein kinase pim-3
Name:Serine/threonine-protein kinase pim-3
Synonyms:Serine/threonine-protein kinase pim-3 (PIM3)
Type:Protein
Mol. Mass.:35888.19
Organism:Homo sapiens (Human)
Description:Q86V86
Residue:326
Sequence:
MLLSKFGSLAHLCGPGGVDHLPVKILQPAKADKESFEKAYQVGAVLGSGGFGTVYAGSRI
ADGLPVAVKHVVKERVTEWGSLGGATVPLEVVLLRKVGAAGGARGVIRLLDWFERPDGFL
LVLERPEPAQDLFDFITERGALDEPLARRFFAQVLAAVRHCHSCGVVHRDIKDENLLVDL
RSGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVC
GDIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGADGGV
PESCDLRLCTLDPDDVASTTSSSESL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM35048
Biotinylated Substrate Peptide
Name:Biotinylated Substrate Peptide
Synonyms:n/a
Type:Peptide
Mol. Mass.:2871.44
Organism:n/a
Description:n/a
Residue:24
Sequence:
biotin-C6linker-VRRLRRLTAREAA