new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual Specificity Protein Phosphatase 1
LigandBDBM35440
Substrate/CompetitorOMFP Substrate
Meas. Tech.In vitro MKP-1 Phosphatase HTS Dose Response Confirmation Assay
pH7±n/a
Temperature295.15±n/a K
IC50>50000±n/a nM
Citation PubChem PC In vitro MKP-1 Phosphatase HTS Dose Response Confirmation Assay PubChem Bioassay (2007)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Dual Specificity Protein Phosphatase 1
Name:Dual Specificity Protein Phosphatase 1
Synonyms:Dual specificity protein phosphatase hVH1 | MAP kinase phosphatase 1 | MKP-1 | Protein-tyrosine phosphatase CL100
Type:Protein phosphatase
Mol. Mass.:39301.48
Organism:Homo sapiens (Human)
Description:gi_4758204
Residue:367
Sequence:
MVMEVGTLDAGGLRALLGERAAQCLLLDCRSFFAFNAGHIAGSVNVRFSTIVRRRAKGAM
GLEHIVPNAELRGRLLAGAYHAVVLLDERSAALDGAKRDGTLALAAGALCREARAAQVFF
LKGGYEAFSASCPELCSKQSTPMGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILPF
LYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEA
IDFIDSIKNAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFS
FMGQLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSP
ITTSPSC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM35440
OMFP Substrate
Name:OMFP Substrate
Synonyms:3-O-methylfluorescein phosphate | OMFP
Type:fluorescent substrate
Mol. Mass.:358.43
Organism:n/a
Description:n/a
Residue:3
Sequence:
n/a