BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase
LigandBDBM36008
Substrate/Competitorn/a
Meas. Tech.SPR biosensor assay Biacore T100
pH7.4±n/a
Temperature298.15±n/a K
Kd 383±n/a nM
KOFF 51000 s-1
KON 0.01956 M-1s-1
Citation Navratilova IHopkins AL Fragment Screening by Surface Plasmon Resonance ACS Med Chem Lett 1:44-8 (2010)  
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Carbonic anhydrase
Name:Carbonic anhydrase
Synonyms:Carbonic anhydrase 2 | Carbonic anhydrase II | Carbonic anhydrase II (CA II) | Carbonic anhydrase II (CA-II)
Type:Enzyme Catalytic Domain
Mol. Mass.:29115.93
Organism:Bos taurus
Description:n/a
Residue:260
Sequence:
MSHHWGYGKHNGPEHWHKDFPIANGERQSPVDIDTKAVVQDPALKPLALVYGEATSRRMV
NNGHSFNVEYDDSQDKAVLKDGPLTGTYRLVQFHFHWGSSDDQGSEHTVDRKKYAAELHL
VHWNTKYGDFGTAAQQPDGLAVVGVFLKVGDANPALQKVLDALDSIKTKGKSTDFPNFDP
GSLLPNVLDYWTYPGSLTTPPLLESVTWIVLKEPISVSSQQMLKFRTLNFNAEGEPELLM
LANWRPAQPLKNRQVRGFPK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM36008
n/a
NameBDBM36008
Synonyms:2-amino-1,3-benzothiazole-6-sulfonamide | SPR_12
TypeSmall organic molecule
Emp. Form.C7H7N3O2S2
Mol. Mass.229.279
SMILESNc1nc2ccc(cc2s1)S(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: