Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin B
LigandBDBM36330
Substrate/CompetitorBDBM36388
Meas. Tech.Assay name: Protease Inhibition Assay
pH5.5±0
Temperature310.15±0 K
IC50 2.2e+2± 0 nM
Citation Kato DBoatright KMBerger ABNazif TBlum GRyan CChehade KASalvesen GSBogyo M Activity-based probes that target diverse cysteine protease families. Nat Chem Biol 1:33-8 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Cathepsin B
Name:Cathepsin B
Synonyms:n/a
Type:Protein
Mol. Mass.:37463.53
Organism:Rattus norvegicus
Description:P00787
Residue:339
Sequence:
MWWSLIPLSCLLALTSAHDKPSSHPLSDDMINYINKQNTTWQAGRNFYNVDISYLKKLCG
TVLGGPNLPERVGFSEDINLPESFDAREQWSNCPTIAQIRDQGSCGSCWAFGAVEAMSDR
ICIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWNFWTRKGLVSGGVYNSHIGCL
PYTIPPCEHHVNGSRPPCTGEGDTPKCNKMCEAGYSTSYKEDKHYGYTSYSVSDSEKEIM
AEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDVMGGHAIRILGWGIENGVPYWLVANSW
NVDWGDNGFFKILRGENHCGIESEIVAGIPRTQQYWGRF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM36330
BDBM36388
NameBDBM36330
Synonyms:AC-YFG-AMOK 10a
TypeSmall organic molecule
Emp. Form.C32H35N3O7
Mol. Mass.573.6362
SMILESCC(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)NCC(=O)COC(=O)c1c(C)cccc1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: