Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetkinesin spindle protein Mutant (D130V)
LigandBDBM36350
Substrate/Competitorn/a
Meas. Tech.HCT116-D130V IC50 biaryl selected
pH6.8±0
IC50 0.83±0.0 nM
Citation Luo LParrish CANevins NMcNulty DEChaudhari AMCarson JDSudakin VShaw ANLehr RZhao HSweitzer SLad LWood KWSakowicz RAnnan RSHuang PSJackson JRDhanak DCopeland RAAuger KR ATP-competitive inhibitors of the mitotic kinesin KSP that function via an allosteric mechanism. Nat Chem Biol 3:722-6 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
kinesin spindle protein Mutant (D130V)
Name:kinesin spindle protein Mutant (D130V)
Synonyms:KSP Mutant (D130V)
Type:PROTEIN
Mol. Mass.:119124.02
Organism:Homo sapiens (Human)
Description:Kinesin-like spindle protein HKSP
Residue:1056
Sequence:
MASQPNSSAKKKEEKGKNIQVVVRCRPFNLAERKASAHSIVECDPVRKEVSVRTGGLADK
SSRKTYTFDMVFGASTKQIDVYRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERS
PNEEYTWEEVPLAGIIPRTLHQIFEKLTDNGTEFSVKVSLLEIYNEELFDLLNPSSDVSE
RLQMFDDPRNKRGVIIKGLEEITVHNKDEVYQILEKGAAKRTTAATLMNAYSSRSHSVFS
VTIHMKETTIDGEELVKIGKLNLVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRVIT
ALVERTPHVPYRESKLTRILQDSLGGRTRTSIIATISPASLNLEETLSTLEYAHRAKNIL
NKPEVNQKLTKKALIKEYTEEIERLKRDLAAAREKNGVYISEENFRVMSGKLTVQEEQIV
ELIEKIGAVEEELNRVTELFMDNKNELDQCKSDLQNKTQELETTQKHLQETKLQLVKEEY
ITSALESTEEKLHDAASKLLNTVEETTKDVSGLHSKLDRKKAVDQHNAEAQDIFGKNLNS
LFNNMEELIKDGSSKQKAMLEVHKTLFGNLLSSSVSALDTITTVALGSLTSIPENVSTHV
SQIFNMILKEQSLAAESKTVLQELINVLKTDLLSSLEMILSPTVVSILKINSQLKHIFKT
SLTVADKIEDQKKELDGFLSILCNNLHELQENTICSLVESQKQCGNLTEDLKTIKQTHSQ
ELCKLMNLWTERFCALEEKCENIQKPLSSVQENIQQKSKDIVNKMTFHSQKFCADSDGFS
QELRNFNQEGTKLVEESVKHSDKLNGNLEKISQETEQRCESLNTRTVYFSEQWVSSLNER
EQELHNLLEVVSQCCEASSSDITEKSDGRKAAHEKQHNIFLDQMTIDEDKLIAQNLELNE
TIKIGLTKLNCFLEQDLKLDIPTGTTPQRKSYLYPSTLVRTEPREHLLDQLKRKQPELLM
MLNCSENNKEETIPDVDVEEAVLGQYTEEPLSQEPSVDAGVDCSSIGGVPFFQHKKSHGK
DKENRGINTLERSKVEETTEHLVTKSRLPLRAQINL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM36350
n/a
NameBDBM36350
Synonyms:6-[4-(Trifluoromethyl)phenyl]-3,4-dihydro-2(1H)-quinolinone | CID12000936 | GSK-1
TypeSmall organic molecule
Emp. Form.C16H12F3NO
Mol. Mass.291.2678
SMILESFC(F)(F)c1ccc(cc1)-c1ccc2NC(=O)CCc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: