Reaction Details |
| Report a problem with these data |
Target | Dimer of Gag-Pol polyprotein [514-612] |
---|
Ligand | BDBM966 |
---|
Substrate/Competitor | HIV Protease Peptide Substrate |
---|
Meas. Tech. | Protease Inhibition Assay |
---|
Ki | 17±n/a nM |
---|
Citation | Scholz, D; Billich, A; Charpiot, B; Ettmayer, P; Lehr, P; Rosenwirth, B; Schreiner, E; Gstach, H Inhibitors of HIV-1 proteinase containing 2-heterosubstituted 4-amino-3-hydroxy-5-phenylpentanoic acid: synthesis, enzyme inhibition, and antiviral activity. J Med Chem37:3079-89 (1994) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Dimer of Gag-Pol polyprotein [514-612] |
---|
Name: | Dimer of Gag-Pol polyprotein [514-612] |
Synonyms: | HIV-2 Protease |
Type: | Protein Complex |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 2 components. |
Component 1 |
Name: | Gag-Pol polyprotein [514-612] |
Synonyms: | HIV-2 Protease chain A | HIV-2 Protease chain B | POL_HV2RO | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10718.25 |
Organism: | Human immunodeficiency virus type 2 |
Description: | P04584[514-612] |
Residue: | 99 |
Sequence: | PQFSLWKRPVVTAYIEGQPVEVLLDTGADDSIVAGIELGNNYSPKIVGGIGGFINTKEYK
NVEIEVLNKKVRATIMTGDTPINIFGRNILTALGMSLNL
|
|
|
Component 2 |
Name: | Gag-Pol polyprotein [514-612] |
Synonyms: | HIV-2 Protease chain A | HIV-2 Protease chain B | POL_HV2RO | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10718.25 |
Organism: | Human immunodeficiency virus type 2 |
Description: | P04584[514-612] |
Residue: | 99 |
Sequence: | PQFSLWKRPVVTAYIEGQPVEVLLDTGADDSIVAGIELGNNYSPKIVGGIGGFINTKEYK
NVEIEVLNKKVRATIMTGDTPINIFGRNILTALGMSLNL
|
|
|
BDBM966 |
---|
HIV Protease Peptide Substrate |
---|
Name: | HIV Protease Peptide Substrate |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 3062.94 |
Organism: | Synthesized |
Description: | n/a |
Residue: | 29 |
Sequence: | H-Lys-Ala-Arg-Val-Leu-pNph-Glu-Ala-Nle-NH2
|
|
|