| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase |
|---|
| Ligand | BDBM22113 |
|---|
| Substrate/Competitor | BDBM22111 |
|---|
| Meas. Tech. | MTAN Inhibition Assay |
|---|
| pH | 7.5±0 |
|---|
| Temperature | 298.15±0 K |
|---|
| Ki | 0.073±5 nM |
|---|
| Citation |  Gutierrez, JA; Crowder, T; Rinaldo-Matthis, A; Ho, MC; Almo, SC; Schramm, VL Transition state analogs of 5'-methylthioadenosine nucleosidase disrupt quorum sensing. Nat Chem Biol5:251-7 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase |
|---|
| Name: | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase |
|---|
| Synonyms: | 5 -methylthioadenosine nucleosidase | 5'-methylthioadenosine nucleosidase | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase (MTAN) | MTA/SAH nucleosidase | MTAN | MTNN_ECOLI | Methylthioadenosine Nucleosidase(MTAN) | P46 | S-adenosylhomocysteine nucleosidase | mtn | mtnN | pfs | yadA |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 24347.14 |
|---|
| Organism: | Escherichia coli (strain K12) |
|---|
| Description: | P0AF12 |
|---|
| Residue: | 232 |
|---|
| Sequence: | MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGAT
LLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFK
ADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAH
VCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG
|
|
|
|---|
| BDBM22113 |
|---|
| BDBM22111 |
|---|
| Name | BDBM22113 |
|---|
| Synonyms: | (3R,4S)-1-({4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl}methyl)-4-[(methylsulfanyl)methyl]pyrrolidin-3-ol | (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-[(methylsulfanyl)methyl]pyrrolidin-3-ol | (3R,4S)-1-[(9-Deazaadenin-9-yl)methyl]-3-hydroxy-4-methylthiomethylpyrrolidine, 7 | DADMe-ImmA-Me | MT-DADMe-ImmA |
|---|
| Type | n/a |
|---|
| Emp. Form. | C13H19N5OS |
|---|
| Mol. Mass. | 293.388 |
|---|
| SMILES | CSC[C@H]1CN(Cc2c[nH]c3c(N)ncnc23)C[C@@H]1O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
