| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mitogen-activated protein kinase 14 |
|---|
| Ligand | BDBM36463 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | MAPK p38 Inhibition Assay |
|---|
| pH | 9.5±0 |
|---|
| Temperature | 289.15±0 K |
|---|
| IC50 | <2±0.0 nM |
|---|
| Citation |  Clark, MA; Acharya, RA; Arico-Muendel, CC; Belyanskaya, SL; Benjamin, DR; Carlson, NR; Centrella, PA; Chiu, CH; Creaser, SP; Cuozzo, JW; Davie, CP; Ding, Y; Franklin, GJ; Franzen, KD; Gefter, ML; Hale, SP; Hansen, NJ; Israel, DI; Jiang, J; Kavarana, MJ; Kelley, MS; Kollmann, CS; Li, F; Lind, K; Mataruse, S; Medeiros, PF; Messer, JA; Myers, P; O'Keefe, H; Oliff, MC; Rise, CE; Satz, AL; Skinner, SR; Svendsen, JL; Tang, L; van Vloten, K; Wagner, RW; Yao, G; Zhao, B; Morgan, BA Design, synthesis and selection of DNA-encoded small-molecule libraries. Nat Chem Biol5:647-54 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Mitogen-activated protein kinase 14 |
|---|
| Name: | Mitogen-activated protein kinase 14 |
|---|
| Synonyms: | CSAID-binding protein | CSBP | CSBP1 | CSBP2 | CSPB1 | Cytokine suppressive anti-inflammatory drug-binding protein | MAP kinase 14 | MAP kinase MXI2 | MAP kinase p38 alpha | MAPK 14 | MAPK14 | MAX-interacting protein 2 | MK14_HUMAN | MXI2 | Mitogen-activated protein kinase p38 alpha | SAPK2A | Stress-activated protein kinase 2a | p38 MAP kinase alpha/beta |
|---|
| Type: | Serine/threonine-protein kinase |
|---|
| Mol. Mass.: | 41286.76 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q16539 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
|
|
|
|---|
| BDBM36463 |
|---|
| n/a |
|---|
| Name | BDBM36463 |
|---|
| Synonyms: | 3-(4-((3-(Aminomethyl)cyclohexyl)methylamino)-6-(3,3-dimethylbutan-2-ylamino)-1,3,5-triazin-2-ylamino)-N-methoxy-4-methylbenzamide | 3-(4-((3-(Aminomethyl)cyclohexyl)methylamino)-6-(cyclohexylamino)-1,3,5-triazin-2-ylamino)-N-methoxy-4-methylbenzamide | DEL-A, 3 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H40N8O2 |
|---|
| Mol. Mass. | 496.6482 |
|---|
| SMILES | CONC(=O)c1ccc(C)c(Nc2nc(NCC3CCCC(CN)C3)nc(NC3CCCCC3)n2)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
