Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 14
LigandBDBM50156750
Substrate/Competitorn/a
Meas. Tech.MAPK p38 Inhibition Assay
pH9.5±0
Temperature289.15±0 K
IC50 18±0.0 nM
Citation Clark MAAcharya RAArico-Muendel CCBelyanskaya SLBenjamin DRCarlson NRCentrella PAChiu CHCreaser SPCuozzo JWDavie CPDing YFranklin GJFranzen KDGefter MLHale SPHansen NJIsrael DIJiang JKavarana MJKelley MSKollmann CSLi FLind KMataruse SMedeiros PFMesser JAMyers PO'Keefe HOliff MCRise CESatz ALSkinner SRSvendsen JLTang Lvan Vloten KWagner RWYao GZhao BMorgan BA Design, synthesis and selection of DNA-encoded small-molecule libraries. Nat Chem Biol 5:647-54 (2009) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Mitogen-activated protein kinase 14
Name:Mitogen-activated protein kinase 14
Synonyms:CSAID-binding protein | CSBP | Cytokine suppressive anti-inflammatory drug-binding protein | MAP Kinase p38 alpha | MAP kinase MXI2 | MAP kinase p38 | MAX-interacting protein 2 | Mitogen-activated protein kinase (MAP) p38 alpha | Mitogen-activated protein kinase (Map p38 alpha) | Mitogen-activated protein kinase 14 (MAP kinase p38 alpha) | Mitogen-activated protein kinase 14 (MAPK14 p38 alpha) | Mitogen-activated protein kinase 14 (MAPK14) | Mitogen-activated protein kinase 14 (MAPK14) (p38 MAPKa) | Mitogen-activated protein kinase 14 (MAPK14) (p38 MAPKÿ±) | Mitogen-activated protein kinase 14 (p38 MAPKa) | Mitogen-activated protein kinase 14 (p38 alpha) | Mitogen-activated protein kinase 14, activated protein kinase p38 alpha | Mitogen-activated protein kinase p38 alpha | Mitogen-activated protein kinase p38 alpha (p38 MAPKa) | SAPK2A | p38-alpha
Type:Serine/threonine-protein kinase
Mol. Mass.:41286.76
Organism:Homo sapiens (Human)
Description:n/a
Residue:360
Sequence:
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50156750
n/a
NameBDBM50156750
Synonyms:CHEMBL376506 | DEL-A, 5 | N-methoxy-4-methyl-3-(4-(methyl(neopentyl)amino)-6-(piperazin-1-yl)-1,3,5-triazin-2-ylamino)benzamide
TypeSmall organic molecule
Emp. Form.C22H34N8O2
Mol. Mass.442.5578
SMILESCONC(=O)c1ccc(C)c(Nc2nc(nc(n2)N2CCNCC2)N(C)CC(C)(C)C)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: