Reaction Details |
| Report a problem with these data |
Target | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase |
---|
Ligand | BDBM36435 |
---|
Substrate/Competitor | BDBM22111 |
---|
Meas. Tech. | Enzyme Activity Assay |
---|
pH | 7.5±0 |
---|
Temperature | 298.15±0 K |
---|
Kd | 0.046±0.0 nM |
---|
Citation | Gutierrez, JA; Luo, M; Singh, V; Li, L; Brown, RL; Norris, GE; Evans, GB; Furneaux, RH; Tyler, PC; Painter, GF; Lenz, DH; Schramm, VL Picomolar inhibitors as transition-state probes of 5'-methylthioadenosine nucleosidases. ACS Chem Biol2:725-34 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase |
---|
Name: | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase |
Synonyms: | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | Methylthioadenosine Nucleosidase (MTAN) |
Type: | Enzyme |
Mol. Mass.: | 24739.13 |
Organism: | Neisseria meningitidis |
Description: | C6S634 |
Residue: | 233 |
Sequence: | MSLKTVTVIGAMEQEIELLREMMENVKAVSFGKFAAYEGELAGKRMVLALSGIGKVNAAV
ATAWLIHQFAPDCVINTGSAGGLGKGLKVGDVVVGTEIAHHDVDVTAFGYVWGQVPQLPA
RFASDGILIETAKRAARTFEGAAVEQGLIVSGDRFVHSSEGVAEIRKHFPEVKAVEMEAA
AIAQTCHQLETPFVIIRAVSDSADEKADISFDEFLKTAAANSAKMVAEIVKSL
|
|
|
BDBM36435 |
---|
BDBM22111 |
---|
Name | BDBM36435 |
Synonyms: | (3R,4S)-1-[(9-Deaza-adenin-9-yl)methyl]-4-ethylthio-methyl-3-hydroxypyrrolidine, 8 | CID11404039 | DADMe-ImmA-Et |
Type | Small organic molecule |
Emp. Form. | C14H21N5OS |
Mol. Mass. | 307.414 |
SMILES | CCSC[C@H]1CN(Cc2c[nH]c3c(N)ncnc23)C[C@@H]1O |
Structure |
|