| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase |
|---|
| Ligand | BDBM50170093 |
|---|
| Substrate/Competitor | BDBM22111 |
|---|
| Meas. Tech. | Enzyme Activity Assay |
|---|
| pH | 7.5±0 |
|---|
| Temperature | 298.15±0 K |
|---|
| Kd | 77±0.0 nM |
|---|
| Citation |  Gutierrez, JA; Luo, M; Singh, V; Li, L; Brown, RL; Norris, GE; Evans, GB; Furneaux, RH; Tyler, PC; Painter, GF; Lenz, DH; Schramm, VL Picomolar inhibitors as transition-state probes of 5'-methylthioadenosine nucleosidases. ACS Chem Biol2:725-34 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase |
|---|
| Name: | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase |
|---|
| Synonyms: | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | MTNN_STAAC | Methylthioadenosine Nucleosidase (MTAN) | mtnN |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 24526.81 |
|---|
| Organism: | Staphylococcus aureus |
|---|
| Description: | Q5HFG2 |
|---|
| Residue: | 228 |
|---|
| Sequence: | MIGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTL
LINKFKPDVIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQS
SKPLIEKVSQVVQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQT
CYQFNVPFVVVRAVSDLANGEAEMSFEAFLEKAAVSSSQTVEALVSQL
|
|
|
|---|
| BDBM50170093 |
|---|
| BDBM22111 |
|---|
| Name | BDBM50170093 |
|---|
| Synonyms: | 2-(4-Amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)-3,4-dihydroxy-5-methylsulfanylmethyl-pyrrolidinium | ImmA-Me |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H18N5O2S |
|---|
| Mol. Mass. | 296.368 |
|---|
| SMILES | CSCC1[NH2+]C(C(O)C1O)c1c[nH]c2c(N)ncnc12 |
|---|
| Structure | 
|
|---|
Search and Browse
