Reaction Details |
| Report a problem with these data |
Target | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase |
---|
Ligand | BDBM36495 |
---|
Substrate/Competitor | BDBM22111 |
---|
Meas. Tech. | Enzyme Activity Assay |
---|
pH | 7.5±0 |
---|
Temperature | 298.15±0 K |
---|
Kd | 12±0.0 nM |
---|
Citation | Gutierrez, JA; Luo, M; Singh, V; Li, L; Brown, RL; Norris, GE; Evans, GB; Furneaux, RH; Tyler, PC; Painter, GF; Lenz, DH; Schramm, VL Picomolar inhibitors as transition-state probes of 5'-methylthioadenosine nucleosidases. ACS Chem Biol2:725-34 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase |
---|
Name: | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase |
Synonyms: | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | MTNN_STAAC | Methylthioadenosine Nucleosidase (MTAN) | mtnN |
Type: | Enzyme |
Mol. Mass.: | 24526.81 |
Organism: | Staphylococcus aureus |
Description: | Q5HFG2 |
Residue: | 228 |
Sequence: | MIGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTL
LINKFKPDVIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQS
SKPLIEKVSQVVQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQT
CYQFNVPFVVVRAVSDLANGEAEMSFEAFLEKAAVSSSQTVEALVSQL
|
|
|
BDBM36495 |
---|
BDBM22111 |
---|
Name | BDBM36495 |
Synonyms: | CHEMBL554642 | ImmA-Bn |
Type | Small organic moelcule |
Emp. Form. | C18H21N5O2S |
Mol. Mass. | 371.457 |
SMILES | Nc1ncnc2c(c[nH]c12)C1NC(CSCc2ccccc2)C(O)C1O |
Structure |
|