Reaction Details |
| Report a problem with these data |
Target | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase |
---|
Ligand | BDBM22113 |
---|
Substrate/Competitor | BDBM22111 |
---|
Meas. Tech. | Enzyme Activity Assay |
---|
pH | 7.5±0 |
---|
Temperature | 298.15±0 K |
---|
Kd | 0.002±0.0 nM |
---|
Citation | Gutierrez, JA; Luo, M; Singh, V; Li, L; Brown, RL; Norris, GE; Evans, GB; Furneaux, RH; Tyler, PC; Painter, GF; Lenz, DH; Schramm, VL Picomolar inhibitors as transition-state probes of 5'-methylthioadenosine nucleosidases. ACS Chem Biol2:725-34 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase |
---|
Name: | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase |
Synonyms: | 5 -methylthioadenosine nucleosidase | 5'-methylthioadenosine nucleosidase | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase (MTAN) | MTA/SAH nucleosidase | MTAN | MTNN_ECOLI | Methylthioadenosine Nucleosidase(MTAN) | P46 | S-adenosylhomocysteine nucleosidase | mtn | mtnN | pfs | yadA |
Type: | Enzyme |
Mol. Mass.: | 24347.14 |
Organism: | Escherichia coli (strain K12) |
Description: | P0AF12 |
Residue: | 232 |
Sequence: | MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGAT
LLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFK
ADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAH
VCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG
|
|
|
BDBM22113 |
---|
BDBM22111 |
---|
Name | BDBM22113 |
Synonyms: | (3R,4S)-1-({4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl}methyl)-4-[(methylsulfanyl)methyl]pyrrolidin-3-ol | (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-[(methylsulfanyl)methyl]pyrrolidin-3-ol | (3R,4S)-1-[(9-Deazaadenin-9-yl)methyl]-3-hydroxy-4-methylthiomethylpyrrolidine, 7 | DADMe-ImmA-Me | MT-DADMe-ImmA |
Type | n/a |
Emp. Form. | C13H19N5OS |
Mol. Mass. | 293.388 |
SMILES | CSC[C@H]1CN(Cc2c[nH]c3c(N)ncnc23)C[C@@H]1O |r| |
Structure |
|