| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dimer of Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM1018 |
|---|
| Substrate/Competitor | Peptide Substrate |
|---|
| Meas. Tech. | Protease Inhibition Assay |
|---|
| pH | 5±n/a |
|---|
| Temperature | 295.15±n/a K |
|---|
| Ki | 0.10±n/a nM |
|---|
| Citation |  Turner, SR; Strohbach, JW; Tommasi, RA; Aristoff, PA; Johnson, PD; Skulnick, HI; Dolak, LA; Seest, EP; Tomich, PK; Bohanon, MJ; Horng, MM; Lynn, JC; Chong, KT; Hinshaw, RR; Watenpaugh, KD; Janakiraman, MN; Thaisrivongs, S Tipranavir (PNU-140690): a potent, orally bioavailable nonpeptidic HIV protease inhibitor of the 5,6-dihydro-4-hydroxy-2-pyrone sulfonamide class. J Med Chem41:3467-76 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Dimer of Gag-Pol polyprotein [489-587] |
|---|
| Name: | Dimer of Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | HIV-1 Protease |
|---|
| Type: | Tandem linked enzyme construct |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | n/a |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| Component 2 |
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM1018 |
|---|
| Peptide Substrate |
|---|
| Name: | Peptide Substrate |
|---|
| Synonyms: | n/a |
|---|
| Type: | Peptide |
|---|
| Mol. Mass.: | 1447.64 |
|---|
| Organism: | n/a |
|---|
| Description: | The peptide was derivatized with biotin and
fluorescein isothiocyanate at the amino and carboxy termini. |
|---|
| Residue: | 12 |
|---|
| Sequence: | |
|---|
Search and Browse
