Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetN-acetyl-beta-D-glucosaminidase (O-GlcNAcase)
LigandBDBM36546
Substrate/CompetitorBDBM18365
Meas. Tech.Enzyme Inhibition Assay
pH4.25±0
Temperature303.15±0 K
Ki 1.077e+5± 9.17e+3 nM
Citation Ho CWPopat SDLiu TWTsai KCHo MJChen WHYang ASLin CH Development of GlcNAc-inspired iminocyclitiols as potent and selective N-acetyl-beta-hexosaminidase inhibitors. ACS Chem Biol 5:489-97 (2010) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
N-acetyl-beta-D-glucosaminidase (O-GlcNAcase)
Name:N-acetyl-beta-D-glucosaminidase (O-GlcNAcase)
Synonyms:2-acetamido-2-deoxy-β-D-glucopyranosidase (O-GlcNAcase) | Beta-N-acetylhexosaminidase | Beta-hexosaminidase (O-GlcNAcase) | Bifunctional protein NCOAT | O-glycoprotein 2-acetamido-2-deoxy-β-D-glucopyranosidase (O-GlcNAcase) | Protein O-GlcNAcase
Type:Enzyme
Mol. Mass.:102874.67
Organism:Homo sapiens (Human)
Description:O60502
Residue:916
Sequence:
MVQKESQATLEERESELSSNPAASAGASLEPPAAPAPGEDNPAGAGGAAVAGAAGGARRF
LCGVVEGFYGRPWVMEQRKELFRRLQKWELNTYLYAPKDDYKHRMFWREMYSVEEAEQLM
TLISAAREYEIEFIYAISPGLDITFSNPKEVSTLKRKLDQVSQFGCRSFALLFDDIDHNM
CAADKEVFSSFAHAQVSITNEIYQYLGEPETFLFCPTEYCGTFCYPNVSQSPYLRTVGEK
LLPGIEVLWTGPKVVSKEIPVESIEEVSKIIKRAPVIWDNIHANDYDQKRLFLGPYKGRS
TELIPRLKGVLTNPNCEFEANYVAIHTLATWYKSNMNGVRKDVVMTDSEDSTVSIQIKLE
NEGSDEDIETDVLYSPQMALKLALTEWLQEFGVPHQYSSRQVAHSGAKASVVDGTPLVAA
PSLNATTVVTTVYQEPIMSQGAALSGEPTTLTKEEEKKQPDEEPMDMVVEKQEETDHKND
NQILSEIVEAKMAEELKPMDTDKESIAESKSPEMSMQEDCISDIAPMQTDEQTNKEQFVP
GPNEKPLYTAEPVTLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRANSSVVSVNCKGKD
SEKIEEWRSRAAKFEEMCGLVMGMFTRLSNCANRTILYDMYSYVWDIKSIMSMVKSFVQW
LGCRSHSSAQFLIGDQEPWAFRGGLAGEFQRLLPIDGANDLFFQPPPLTPTSKVYTIRPY
FPKDEASVYKICREMYDDGVGLPFQSQPDLIGDKLVGGLLSLSLDYCFVLEDEDGICGYA
LGTVDVTPFIKKCKISWIPFMQEKYTKPNGDKELSEAEKIMLSFHEEQEVLPETFLANFP
SLIKMDIHKKVTDPSVAKSMMACLLSSLKANGSRGAFCEVRPDDKRILEFYSKLGCFEIA
KMEGFPKDVVILGRSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM36546
BDBM18365
NameBDBM36546
Synonyms:N-[1-(7-aminoheptyl)-4,5-dihydroxy-6-(hydroxymethyl)piperidin-3-yl]acetamide, 2
Typesmall organic molecule
Emp. Form.C15H31N3O4
Mol. Mass.317.4243
SMILESCC(=O)NC1CN(CCCCCCCN)C(CO)C(O)C1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: