Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-hexosaminidase subunit beta (Hex B)
LigandBDBM50182804
Substrate/CompetitorBDBM18365
Meas. Tech.Enzyme Inhibition Assay
pH4.25±0
Temperature303.15±0 K
Ki 5.4e+2± 2.5e+2 nM
Citation Ho CWPopat SDLiu TWTsai KCHo MJChen WHYang ASLin CH Development of GlcNAc-inspired iminocyclitiols as potent and selective N-acetyl-beta-hexosaminidase inhibitors. ACS Chem Biol 5:489-97 (2010) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Beta-hexosaminidase subunit beta (Hex B)
Name:Beta-hexosaminidase subunit beta (Hex B)
Synonyms:Beta-N-acetylhexosaminidase subunit beta | Beta-hexosaminidase subunit beta | HEXB | Hexosaminidase subunit B
Type:Enzyme
Mol. Mass.:63112.58
Organism:Homo sapiens (Human)
Description:P07686
Residue:556
Sequence:
MELCGLGLPRPPMLLALLLATLLAAMLALLTQVALVVQVAEAARAPSVSAKPGPALWPLP
LSVKMTPNLLHLAPENFYISHSPNSTAGPSCTLLEEAFRRYHGYIFGFYKWHHEPAEFQA
KTQVQQLLVSITLQSECDAFPNISSDESYTLLVKEPVAVLKANRVWGALRGLETFSQLVY
QDSYGTFTINESTIIDSPRFSHRGILIDTSRHYLPVKIILKTLDAMAFNKFNVLHWHIVD
DQSFPYQSITFPELSNKGSYSLSHVYTPNDVRMVIEYARLRGIRVLPEFDTPGHTLSWGK
GQKDLLTPCYSRQNKLDSFGPINPTLNTTYSFLTTFFKEISEVFPDQFIHLGGDEVEFKC
WESNPKIQDFMRQKGFGTDFKKLESFYIQKVLDIIATINKGSIVWQEVFDDKAKLAPGTI
VEVWKDSAYPEELSRVTASGFPVILSAPWYLDLISYGQDWRKYYKVEPLDFGGTQKQKQL
FIGGEACLWGEYVDATNLTPRLWPRASAVGERLWSSKDVRDMDDAYDRLTRHRCRMVERG
IAAQPLYAGYCNHENM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50182804
BDBM18365
NameBDBM50182804
Synonyms:2-ACETAMIDO-1,2-DIDEOXYNOJIRMYCIN | CHEMBL382689 | Iminocyclitol, 5 | N-((3S,4R,5R,6R)-4,5-dihydroxy-6-(hydroxymethyl)piperidin-3-yl)acetamide | N-[4,5-dihydroxy-6-(hydroxymethyl)piperidin-3-yl]acetamide, 1
TypeSmall organic molecule
Emp. Form.C8H16N2O4
Mol. Mass.204.2236
SMILESCC(=O)N[C@H]1CN[C@H](CO)[C@@H](O)[C@@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: