Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclic AMP-dependent protein kinase (PKA)
LigandBDBM3207
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
pH7.5±0
Temperature303.15±0 K
Ki 3.9±0 nM
IC50 6.3±0.0 nM
Citation Koide KBunnage MEGomez Paloma LKanter JRTaylor SSBrunton LLNicolaou KC Molecular design and biological activity of potent and selective protein kinase inhibitors related to balanol. Chem Biol 2:601-8 (1995) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Cyclic AMP-dependent protein kinase (PKA)
Name:Cyclic AMP-dependent protein kinase (PKA)
Synonyms:PKA catalytic subunit alpha | Serine/threonine-protein kinase | cAMP-dependent protein kinase alpha-catalytic subunit
Type:Enzyme
Mol. Mass.:40766.33
Organism:Oryctolagus cuniculus (Rabbit)
Description:Q95J97
Residue:351
Sequence:
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAQLDQFERIKTLGTGSFGRVML
SKHKETGNHYAMKILDKQKVVKLKQIEHTLNVKRILQAVNFPFLVKLEFSFKENSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQQTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAADYPPFF
ADQPIQIYEKIVYGKVRFPSHFSSDLKDLLRNLQQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM3207
n/a
NameBDBM3207
Synonyms:10''-Deoxybalanol, 4 | 2-{[2,6-dihydroxy-4-({[(3R,4R)-3-[(4-hydroxybenzene)amido]azepan-4-yl]oxy}carbonyl)phenyl]carbonyl}benzoic acid | 4-trans-[4-(2-Carboxybenzoyl)-3,5-dihydroxybenzoyloxy]-3-(4-hydroxybenzamido)azepane | CHEMBL193697 | Modified Benzophenone Ring, Balanol Analog 7
TypeSmall organic molecule
Emp. Form.C28H26N2O9
Mol. Mass.534.514
SMILESOC(=O)c1ccccc1C(=O)c1c(O)cc(cc1O)C(=O)O[C@@H]1CCCNC[C@H]1NC(=O)c1ccc(O)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: