Reaction Details |
| Report a problem with these data |
Target | HIV-1 protease |
---|
Ligand | BDBM36649 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Protease Inhibtion Assay |
---|
pH | 5.5±0 |
---|
Ki | 0.018±0.0 nM |
---|
Citation | Rodgers, JD; Lam, PY; Johnson, BL; Wang, H; Li, R; Ru, Y; Ko, SS; Seitz, SP; Trainor, GL; Anderson, PS; Klabe, RM; Bacheler, LT; Cordova, B; Garber, S; Reid, C; Wright, MR; Chang, CH; Erickson-Viitanen, S Design and selection of DMP 850 and DMP 851: the next generation of cyclic urea HIV protease inhibitors. Chem Biol5:597-608 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
HIV-1 protease |
---|
Name: | HIV-1 protease |
Synonyms: | HIV-1 protease wild type |
Type: | Protein |
Mol. Mass.: | 10757.68 |
Organism: | Human immunodeficiency virus |
Description: | O90785 |
Residue: | 99 |
Sequence: | PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYE
QVLIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF
|
|
|
BDBM36649 |
---|
n/a |
---|
Name | BDBM36649 |
Synonyms: | 3-alkylaminoindazole cyclic urea, (Me) |
Type | Small organic molecule |
Emp. Form. | C37H40N8O3 |
Mol. Mass. | 644.7653 |
SMILES | CNc1n[nH]c2ccc(CN3[C@H](Cc4ccccc4)[C@H](O)[C@@H](O)[C@@H](Cc4ccccc4)N(Cc4ccc5[nH]nc(NC)c5c4)C3=O)cc12 |r| |
Structure |
|