Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoic Acid Receptor, gamma
LigandBDBM31889
Substrate/Competitorn/a
Meas. Tech.Competitive Assay
pH8±0
Temperature277.15±0 K
Ki 1.5±0.0 nM
Citation Géhin MVivat VWurtz JMLosson RChambon PMoras DGronemeyer H Structural basis for engineering of retinoic acid receptor isotype-selective agonists and antagonists. Chem Biol 6:519-29 (1999) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Retinoic Acid Receptor, gamma
Name:Retinoic Acid Receptor, gamma
Synonyms:Nuclear receptor subfamily 1 group B member 3 | RAR-gamma
Type:Ligand-binding domain
Mol. Mass.:26502.27
Organism:Homo sapiens (Human)
Description:n/a
Residue:235
Sequence:
SPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIV
EFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALR
LYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31889
n/a
NameBDBM31889
Synonyms:BMS 961 | BMS270394 | BMS961
TypeSmall organic molecule
Emp. Form.C23H26FNO4
Mol. Mass.399.4552
SMILESCC1(C)CCC(C)(C)c2cc(ccc12)[C@@H](O)C(=O)Nc1ccc(cc1F)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: