| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Retinoic acid receptor alpha [200-419]/gamma [183-417] |
|---|
| Ligand | BDBM36810 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Competitive Assay |
|---|
| pH | 8±0 |
|---|
| Temperature | 277.15±0 K |
|---|
| Ki | 1.0±0.0 nM |
|---|
| Citation |  Géhin, M; Vivat, V; Wurtz, JM; Losson, R; Chambon, P; Moras, D; Gronemeyer, H Structural basis for engineering of retinoic acid receptor isotype-selective agonists and antagonists. Chem Biol6:519-29 (1999) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Retinoic acid receptor alpha [200-419]/gamma [183-417] |
|---|
| Name: | Retinoic acid receptor alpha [200-419]/gamma [183-417] |
|---|
| Synonyms: | Retinoic Acid Receptors Gamma / Alpha |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | n/a |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | Retinoic acid receptor gamma [183-417] |
|---|
| Synonyms: | NR1B3 | Nuclear receptor subfamily 1 group B member 3 | RAR-gamma | RARG | RARG_HUMAN | Retinoic Acid Receptor, gamma |
|---|
| Type: | Ligand-binding domain |
|---|
| Mol. Mass.: | 26502.27 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P13631[183-417] |
|---|
| Residue: | 235 |
|---|
| Sequence: | SPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIV
EFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALR
LYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLE
|
|
|
|---|
| Component 2 |
| Name: | Retinoic acid receptor alpha [200-419] |
|---|
| Synonyms: | NR1B1 | Nuclear receptor subfamily 1 group B member 1 | RAR-alpha | RARA | RARA_HUMAN | Retinoic Acid Receptor, alpha |
|---|
| Type: | Ligand-binding domain |
|---|
| Mol. Mass.: | 24746.59 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P10276[200-419] |
|---|
| Residue: | 220 |
|---|
| Sequence: | PALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQIT
LLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPL
EMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLM
KITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEG
|
|
|
|---|
| BDBM36810 |
|---|
| n/a |
|---|
| Name | BDBM36810 |
|---|
| Synonyms: | BMS753 | US9963439, BMS753 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H21NO4 |
|---|
| Mol. Mass. | 351.3957 |
|---|
| SMILES | CC1(C)C(=O)C(C)(C)c2cc(ccc12)C(=O)Nc1ccc(cc1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
