new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase Blk
LigandBDBM13216
Substrate/Competitorn/a
Meas. Tech.Kinase Inhibitor Selectivity Profiling Assay
Kd 0.21±n/a nM
Citation PubChem PC Kinase Inhibitor Selectivity Profiling Assay PubChem Bioassay (2008)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Tyrosine-protein kinase Blk
Name:SRC
Synonyms:B lymphoid tyrosine kinase | BLK | Tyrosine-protein kinase BLK (BLK) | p55-Blk
Type:Protein
Mol. Mass.:57711.88
Organism:Homo sapiens (Human)
Description:n/a
Residue:505
Sequence:
MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDK
HFVVALYDYTAMNDRDLQMLKGEKLQVLKGTGDWWLARSLVTGREGYVPSNFVARVESLE
MERWFFRSQGRKEAERQLLAPINKAGSFLIRESETNKGAFSLSVKDVTTQGELIKHYKIR
CLDEGGYYISPRITFPSLQALVQHYSKKGDGLCQRLTLPCVRPAPQNPWAQDEWEIPRQS
LRLVRKLGSGQFGEVWMGYYKNNMKVAIKTLKEGTMSPEAFLGEANVMKALQHERLVRLY
AVVTKEPIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQIAEGMAYIERMNSIHRD
LRAANILVSEALCCKIADFGLARIIDSEYTAQEGAKFPIKWTAPEAIHFGVFTIKADVWS
FGVLLMEVVTYGRVPYPGMSNPEVIRNLERGYRMPRPDTCPPELYRGVIAECWRSRPEER
PTFEFLQSVLEDFYTATERQYELQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM13216
n/a
NameBDBM13216
Synonyms:BMS-354825 | CHEMBL1421 | DASATINIB | N-(2-Chloro-6-methylphenyl)-2-[[6-[4-(2-hydroxyethyl)-1-piperazinyl)]-2-methyl-4-pyrimidinyl]amino)]-1,3-thiazole-5-carboxamide | N-(2-chloro-6-methylphenyl)-2-({6-[4-(2-hydroxyethyl)piperazin-1-yl]-2-methylpyrimidin-4-yl}amino)-1,3-thiazole-5-carboxamide | cid_3062316
TypeSmall organic molecule
Emp. Form.C22H26ClN7O2S
Mol. Mass.488.006
SMILESCc1nc(Nc2ncc(s2)C(=O)Nc2c(C)cccc2Cl)cc(n1)N1CCN(CCO)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: