new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase Fgr
LigandBDBM31096
Substrate/Competitorn/a
Meas. Tech.Kinase Inhibitor Selectivity Profiling Assay
Kd 17±n/a nM
Citation PubChem PC Kinase Inhibitor Selectivity Profiling Assay PubChem Bioassay (2008)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Tyrosine-protein kinase Fgr
Name:Tyrosine-protein kinase Fgr
Synonyms:FGR | Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog | Proto-oncogene c-Fgr | SRC2 | p55-Fgr | p58-Fgr | p58c-Fgr
Type:protein
Mol. Mass.:59469.88
Organism:Homo sapiens (Human)
Description:P09769
Residue:529
Sequence:
MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQA
INPGFLDSGTIRGVSGIGVTLFIALYDYEARTEDDLTFTKGEKFHILNNTEGDWWEARSL
SSGKTGCIPSNYVAPVDSIQAEEWYFGKIGRKDAERQLLSPGNPQGAFLIRESETTKGAY
SLSIRDWDQTRGDHVKHYKIRKLDMGGYYITTRVQFNSVQELVQHYMEVNDGLCNLLIAP
CTIMKPQTLGLAKDAWEISRSSITLERRLGTGCFGDVWLGTWNGSTKVAVKTLKPGTMSP
KAFLEEAQVMKLLRHDKLVQLYAVVSEEPIYIVTEFMCHGSLLDFLKNPEGQDLRLPQLV
DMAAQVAEGMAYMERMNYIHRDLRAANILVGERLACKIADFGLARLIKDDEYNPCQGSKF
PIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMNKREVLEQVEQGYHMPCP
PGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31096
n/a
NameBDBM31096
Synonyms:CHEMBL290084 | Staurosporine | cid_451705
TypeSmall organic molecule
Emp. Form.C28H26N4O3
Mol. Mass.466.531
SMILESCN[C@H]1C[C@@H]2O[C@](C)([C@H]1OC)n1c3ccccc3c3c4CNC(=O)c4c4c5ccccc5n2c4c13
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: