Reaction Details |
 | Report a problem with these data |
Target | HIV-1 Protease |
---|
Ligand | BDBM150 |
---|
Substrate/Competitor | Peptide substrate |
---|
Meas. Tech. | Protease Inhibition Assay |
---|
pH | 5.5±n/a |
---|
Temperature | 310.15±n/a K |
---|
Ki | <1±n/a nM |
---|
IC50 | 15±n/a nM |
---|
Citation | Hulten J; Bonham NM; Nillroth U; Hansson T; Zuccarello G; Bouzide A; Aqvist J; Classon B; Danielson UH; Karlen A; Kvarnstrom I; Samuelsson B; Hallberg A Cyclic HIV-1 protease inhibitors derived from mannitol: synthesis, inhibitory potencies, and computational predictions of binding affinities. J Med Chem 40:885-97 (1997) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
HIV-1 Protease |
---|
Name: | HIV-1 Protease |
Synonyms: | n/a |
Type: | Protein Complex |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 2 components. |
Component 1 |
Name: | HIV-1 Protease chain A |
Synonyms: | HIV-1 Protease (NY5-type sequence) |
Type: | Enzyme Subunit |
Mol. Mass.: | 10822.21 |
Organism: | Human immunodeficiency virus type 1 |
Description: | n/a |
Residue: | 99 |
Sequence: | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
Component 2 |
Name: | HIV-1 Protease chain A |
Synonyms: | HIV-1 Protease (NY5-type sequence) |
Type: | Enzyme Subunit |
Mol. Mass.: | 10822.21 |
Organism: | Human immunodeficiency virus type 1 |
Description: | n/a |
Residue: | 99 |
Sequence: | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM150 |
---|
Peptide substrate |
---|
Name: | Peptide substrate |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 358.43 |
Organism: | n/a |
Description: | n/a |
Residue: | 3 |
Sequence: | |