new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphorylase kinase
LigandBDBM5931
Substrate/Competitorn/a
Meas. Tech.Kinase Inhibitor Selectivity Profiling Assay
Kd 3800±n/a nM
Citation PubChem PC Kinase Inhibitor Selectivity Profiling Assay PubChem Bioassay (2008)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Phosphorylase kinase
Name:Phosphorylase kinase
Synonyms:PHKG1 | Phosphorylase b kinase gamma catalytic chain, skeletal muscle isoform | Phosphorylase kinase gamma subunit 1 | Phosphorylase kinase subunit gamma 1
Type:PROTEIN
Mol. Mass.:45025.22
Organism:Homo sapiens (Human)
Description:ChEMBL_774515
Residue:387
Sequence:
MTRDEALPDSHSAQDFYENYEPKEILGRGVSSVVRRCIHKPTSQEYAVKVIDVTGGGSFS
PEEVRELREATLKEVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKV
TLSEKETRKIMRALLEVICTLHKLNIVHRDLKPENILLDDNMNIKLTDFGFSCQLEPGER
LREVCGTPSYLAPEIIECSMNEDHPGYGKEVDMWSTGVIMYTLLAGSPPFWHRKQMLMLR
MIMSGNYQFGSPEWDDYSDTVKDLVSRFLVVQPQNRYTAEEALAHPFFQQYLVEEVRHFS
PRGKFKVIALTVLASVRIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAYAFRIYGHWVK
KGQQQNRAALFENTPKAVLLSLAEEDY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM5931
n/a
NameBDBM5931
Synonyms:BMS-387072 | CHEMBL296468 | N-(5-{[(5-tert-butyl-1,3-oxazol-2-yl)methyl]sulfanyl}-1,3-thiazol-2-yl)piperidine-4-carboxamide | N-[5-[[[5-(1,1-Dimethylethyl)-2-oxazolyl]methyl]thio]-2-thiazolyl]-4-piperidinecarboxamide | cid_3025986
TypeSmall organic molecule
Emp. Form.C17H24N4O2S2
Mol. Mass.380.528
SMILESCC(C)(C)c1cnc(CSc2cnc(NC(=O)C3CCNCC3)s2)o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: