new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSphingosine 1-phosphate receptor 1
LigandBDBM36908
Substrate/Competitorn/a
Meas. Tech.Dose Response Assays for S1P1 Agonists and Agonism Potentiators - Agonist Assay 60K MLSMR
EC50 8337±n/a nM
Citation PubChem PC Dose Response Assays for S1P1 Agonists and Agonism Potentiators - Agonist Assay 60K MLSMR PubChem Bioassay (2007)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Sphingosine 1-phosphate receptor 1
Name:Sphingosine 1-phosphate receptor
Synonyms:CHEDG1 | EDG1 | Endothelial differentiation G-protein coupled receptor 1 | S1P receptor | S1P1 | S1PR1 | Sphingosine 1-phosphate receptor 1 (S1PR1) | Sphingosine 1-phosphate receptor Edg-1
Type:Enzyme
Mol. Mass.:42836.02
Organism:Homo sapiens (Human)
Description:P21453
Residue:382
Sequence:
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM36908
n/a
NameBDBM36908
Synonyms:2-methoxy-4-(5-piperidin-1-ylpenta-1,3-diynyl)phenol;hydrochloride | 2-methoxy-4-(5-piperidinopenta-1,3-diynyl)phenol;hydrochloride | 2-methoxy-4-[5-(1-piperidinyl)penta-1,3-diynyl]phenol;hydrochloride | MLS000078799 | SMR000057989 | cid_2852203
TypeSmall organic molecule
Emp. Form.C17H19NO2
Mol. Mass.269.3383
SMILESCOc1cc(ccc1O)C#CC#CCN1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: