new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetmevalonate kinase
LigandBDBM38617
Substrate/Competitorn/a
Meas. Tech.Screening for Inhibitors of the Mevalonate Pathway in Streptococcus Pneumoniae - MK Dose Response
IC50>9999000±n/a nM
Citation PubChem PC Screening for Inhibitors of the Mevalonate Pathway in Streptococcus Pneumoniae - MK Dose Response PubChem Bioassay (2007)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
mevalonate kinase
Name:mevalonate kinase
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:31420.64
Organism:Streptococcus pneumoniae D39
Description:A0A0H2ZQX9
Residue:292
Sequence:
MTKKVGVGQAHSKIILIGEHAVVYGYPAISLPLLEVEVTCKVVPAESPWRLYEEDTLSMA
VYASLEYLNITEACIRCEIDSAIPEKRGMGSSAAISIAAIRAVFDYYQADLPHDVLEILV
NRAEMIAHMNPSGLDAKTCLSDQPIRFIKNVGFTELEMDLSAYLVIADTGVYGHTREAIQ
VVQNKGKDALPFLHALGELTQQAEIAISQKDAEGLGQILSQAHLHLKEIGVSSLEADSLV
ETALSHGALGAKMSGGGLGGCIIALVTNLTHAQELAERLEEKGAVQTWIESL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM38617
n/a
NameBDBM38617
Synonyms:MLS000092916 | N-[2-(diethylamino)ethyl]-5-(4-keto-8-methoxy-2-thioxo-1,5-dihydropyrimid[5,4-b]indol-3-yl)valeramide | N-[2-(diethylamino)ethyl]-5-(8-methoxy-4-oxidanylidene-2-sulfanylidene-1,5-dihydropyrimido[5,4-b]indol-3-yl)pentanamide | N-[2-(diethylamino)ethyl]-5-(8-methoxy-4-oxo-2-sulfanylidene-1,5-dihydropyrimido[5,4-b]indol-3-yl)pentanamide | N-[2-(diethylamino)ethyl]-5-(8-methoxy-4-oxo-2-thioxo-1,2,4,5-tetrahydro-3H-pyrimido[5,4-b]indol-3-yl)pentanamide | SMR000028552 | cid_3244883
TypeSmall organic molecule
Emp. Form.C22H31N5O3S
Mol. Mass.445.578
SMILESCCN(CC)CCNC(=O)CCCCn1c(=S)[nH]c2c3cc(OC)ccc3[nH]c2c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: