new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein phosphatase non-receptor type 22
LigandBDBM34230
Substrate/Competitorn/a
Meas. Tech.HTS for LYP Inhibitors-an Autoimmunity Target - Primary screen
IC50 6690±n/a nM
Citation PubChem PC HTS for LYP Inhibitors-an Autoimmunity Target - Primary screen PubChem Bioassay (2007)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Tyrosine-protein phosphatase non-receptor type 22
Name:Hematopoietic cell protein-tyrosine phosphatase 70Z-PEP
Synonyms:Hematopoietic cell protein-tyrosine phosphatase 70Z-PEP | LyP | Lymphoid phosphatase | Lymphoid phosphatase (Lyp) | PEP | PEST-domain phosphatase | PTPN22 | PTPN8 | Tyrosine-protein phosphatase non-receptor type 22 (LYP) | tyrosine-protein phosphatase non-receptor type 22 isoform 1
Type:n/a
Mol. Mass.:91712.31
Organism:Homo sapiens (Human)
Description:Q9Y2R2
Residue:807
Sequence:
MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRY
KDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEY
SVLIIVMACMEYEMGKKKCERYWAEPGEMQLEFGPFSVSCEAEKRKSDYIIRTLKVKFNS
ETRTIYQFHYKNWPDHDVPSSIDPILELIWDVRCYQEDDSVPICIHCSAGCGRTGVICAI
DYTWMLLKDGIIPENFSVFSLIREMRTQRPSLVQTQEQYELVYNAVLELFKRQMDVIRDK
HSGTESQAKHCIPEKNHTLQADSYSPNLPKSTTKAAKMMNQQRTKMEIKESSSFDFRTSE
ISAKEELVLHPAKSSTSFDFLELNYSFDKNADTTMKWQTKAFPIVGEPLQKHQSLDLGSL
LFEGCSNSKPVNAAGRYFNSKVPITRTKSTPFELIQQRETKEVDSKENFSYLESQPHDSC
FVEMQAQKVMHVSSAELNYSLPYDSKHQIRNASNVKHHDSSALGVYSYIPLVENPYFSSW
PPSGTSSKMSLDLPEKQDGTVFPSSLLPTSSTSLFSYYNSHDSLSLNSPTNISSLLNQES
AVLATAPRIDDEIPPPLPVRTPESFIVVEEAGEFSPNVPKSLSSAVKVKIGTSLEWGGTS
EPKKFDDSVILRPSKSVKLRSPKSELHQDRSSPPPPLPERTLESFFLADEDCMQAQSIET
YSTSYPDTMENSTSSKQTLKTPGKSFTRSKSLKILRNMKKSICNSCPPNKPAESVQSNNS
SSFLNFGFANRFSKPKGPRNPPPTWNI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM34230
n/a
NameBDBM34230
Synonyms:(Z)-7-[(1R,2S)-2-[(E,3S)-3-hydroxyoct-1-enyl]-5-keto-cyclopent-3-en-1-yl]hept-5-enoic acid | (Z)-7-[(1R,2S)-2-[(E,3S)-3-hydroxyoct-1-enyl]-5-oxo-1-cyclopent-3-enyl]-5-heptenoic acid | (Z)-7-[(1R,2S)-2-[(E,3S)-3-hydroxyoct-1-enyl]-5-oxocyclopent-3-en-1-yl]hept-5-enoic acid | (Z)-7-[(1R,5S)-2-oxidanylidene-5-[(E,3S)-3-oxidanyloct-1-enyl]cyclopent-3-en-1-yl]hept-5-enoic acid | MLS000069589 | PROSTAGLANDIN A2 | SMR000058790 | cid_5280880
TypeSmall organic molecule
Emp. Form.C20H30O4
Mol. Mass.334.4498
SMILESCCCCC[C@H](O)C=C[C@H]1C=CC(=O)[C@@H]1C\C=C/CCCC(O)=O |c:10|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: