new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNuclear receptor ROR-alpha
LigandBDBM38924
Substrate/Competitorn/a
Meas. Tech.Dose-response cell-based assay for inhibitors of the Retinoic Acid Receptor-related orphan receptor A (RORA)
IC50 2946±n/a nM
Citation PubChem PC Dose-response cell-based assay for inhibitors of the Retinoic Acid Receptor-related orphan receptor A (RORA) PubChem Bioassay (2007)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Nuclear receptor ROR-alpha
Name:Nuclear receptor ROR-alpha
Synonyms:Nuclear receptor ROR-alpha (Retinoid-related orphan receptor-alpha) (Nuclear receptor RZR-alpha).
Type:PROTEIN
Mol. Mass.:63033.59
Organism:Homo sapiens (Human)
Description:EBI_101591
Residue:556
Sequence:
MNEGAPGDSDLETEARVPWSIMGHCLRTGQARMSATPTPAGEGARRDELFGILQILHQCI
LSSGDAFVLTGVCCSWRQNGKPPYSQKEDKEVQTGYMNAQIEIIPCKICGDKSSGIHYGV
ITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGR
MSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAEPLTPTYNISANGLTELHDDLSNYIDGH
TPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFPYCSFTNGETSPT
VSMAELEHLAQNISKSHLETCQYLREELQQITWQTFLQEEIENYQNKQREVMWQLCAIKI
TEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYAS
PDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEIALFSAFVLMSADRSWLQEKVKIEKLQQ
KIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMAFKAIYPDIVRLHFPPLY
KELFTSEFEPAMQIDG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM38924
n/a
NameBDBM38924
Synonyms:2,6-bis(2-pyridinyl)pyridine | 2,6-bis(2-pyridyl)pyridine | 2,6-dipyridin-2-ylpyridine | MLS000048666 | SMR000060049 | cid_70848
TypeSmall organic molecule
Emp. Form.C15H11N3
Mol. Mass.233.2679
SMILESc1ccc(nc1)-c1cccc(n1)-c1ccccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: