new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity phosphatase Cdc25B
LigandBDBM32102
Substrate/Competitorn/a
Meas. Tech.Cdc25B Catalytic Domain Protein Tyrosine Phosphatase Probe Assessment Dose Response assay in the presence of Glutathione.
IC50 35510±n/a nM
Citation PubChem PC Cdc25B Catalytic Domain Protein Tyrosine Phosphatase Probe Assessment Dose Response assay in the presence of Glutathione. PubChem Bioassay (2007)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Dual specificity phosphatase Cdc25B
Name:Dual specificity phosphatase Cdc25B
Synonyms:Dual specificity phosphatase (CDC25B) | M-phase inducer phosphatase 2 (CDC25B)
Type:Protein
Mol. Mass.:64985.27
Organism:Homo sapiens (Human)
Description:n/a
Residue:580
Sequence:
MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASSPVTTLTQTMH
DLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSESSDAGLCMDSPSPMD
PHMAEQTFEQAIQAASRIIRNEQFAIRRFQSMPVRLLGHSPVLRNITNSQAPDGRRKSEA
GSGAASSSGEDKENDGFVFKMPWKPTHPSSTHALAEWASRREAFAQRPSSAPDLMCLSPD
RKMEVEELSPLALGRFSLTPAEGDTEEDDGFVDILESDLKDDDAVPPGMESLISAPLVKT
LEKEEEKDLVMYSKCQRLFRSPSMPCSVIRPILKRLERPQDRDTPVQNKRRRSVTPPEEQ
QEAEEPKARVLRSKSLCHDEIENLLDSDHRELIGDYSKAFLLQTVDGKHQDLKYISPETM
VALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPCSLDKR
VILIFHCEFSSERGPRMCRFIRERDRAVNDYPSLYYPEMYILKGGYKEFFPQHPNFCEPQ
DYRPMNHEAFKDELKTFRLKTRSWAGERSRRELCSRLQDQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM32102
n/a
NameBDBM32102
Synonyms:1,6-dimethylpyrimido[5,4-e][1,2,4]triazine-5,7(1H,6H)-dione | 1,6-dimethylpyrimido[5,4-e][1,2,4]triazine-5,7-dione | 1,6-dimethylpyrimido[5,4-e][1,2,4]triazine-5,7-quinone | MLS000087831 | SMR000024051 | US9284299, PKF118-310 | US9738628, Compound PKF118-310 | cid_66541
TypeSmall organic molecule
Emp. Form.C7H7N5O2
Mol. Mass.193.1628
SMILESCn1ncnc2c1nc(=O)n(C)c2=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: