new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual Specificity Protein Phosphatase 1
LigandBDBM32102
Substrate/Competitorn/a
Meas. Tech.Cdc25B Catalytic Domain Protein Tyrosine Phosphatase Probe Assessment: MKP-1 Dose Response Selectivity comparison.
IC50 423±n/a nM
Citation PubChem PC Cdc25B Catalytic Domain Protein Tyrosine Phosphatase Probe Assessment: MKP-1 Dose Response Selectivity comparison. PubChem Bioassay (2007)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Dual Specificity Protein Phosphatase 1
Name:Dual Specificity Protein Phosphatase 1
Synonyms:Dual specificity protein phosphatase hVH1 | MAP kinase phosphatase 1 | MKP-1 | Protein-tyrosine phosphatase CL100
Type:Protein phosphatase
Mol. Mass.:39301.48
Organism:Homo sapiens (Human)
Description:gi_4758204
Residue:367
Sequence:
MVMEVGTLDAGGLRALLGERAAQCLLLDCRSFFAFNAGHIAGSVNVRFSTIVRRRAKGAM
GLEHIVPNAELRGRLLAGAYHAVVLLDERSAALDGAKRDGTLALAAGALCREARAAQVFF
LKGGYEAFSASCPELCSKQSTPMGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILPF
LYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEA
IDFIDSIKNAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFS
FMGQLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSP
ITTSPSC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM32102
n/a
NameBDBM32102
Synonyms:1,6-dimethylpyrimido[5,4-e][1,2,4]triazine-5,7(1H,6H)-dione | 1,6-dimethylpyrimido[5,4-e][1,2,4]triazine-5,7-dione | 1,6-dimethylpyrimido[5,4-e][1,2,4]triazine-5,7-quinone | MLS000087831 | SMR000024051 | US9284299, PKF118-310 | US9738628, Compound PKF118-310 | cid_66541
TypeSmall organic molecule
Emp. Form.C7H7N5O2
Mol. Mass.193.1628
SMILESCn1ncnc2c1nc(=O)n(C)c2=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: